Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse EDA2R Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q8BX35
Molecular weight:
37.59 kDa

Original price was: $370.00.Current price is: $327.00.

100ug 12% OFF + 327 loyalty points
Asp2–Cys86
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse EDA2R Protein, N-GST & C-His

Product name ARO-P10499-100
Uniprot ID Q8BX35
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDC
Molecular weight 37.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Cys86
Aliases /Synonyms EDA-A2 receptor, XEDAR, EDA2R, TNFRSF27, X-linked ectodysplasin-A2 receptor, Tumor necrosis factor receptor superfamily member 27
Reference ARO-P10499
Note For research use only.
Molecular Constructor
Asp2–Cys86
Product name ARO-P10499-1MG
Uniprot ID Q8BX35
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDC
Molecular weight 37.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Cys86
Aliases /Synonyms EDA-A2 receptor, XEDAR, EDA2R, TNFRSF27, X-linked ectodysplasin-A2 receptor, Tumor necrosis factor receptor superfamily member 27
Reference ARO-P10499
Note For research use only.
Molecular Constructor
Asp2–Cys86
Product name ARO-P10499-50
Uniprot ID Q8BX35
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDC
Molecular weight 37.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Cys86
Aliases /Synonyms EDA-A2 receptor, XEDAR, EDA2R, TNFRSF27, X-linked ectodysplasin-A2 receptor, Tumor necrosis factor receptor superfamily member 27
Reference ARO-P10499
Note For research use only.
Molecular Constructor
Asp2–Cys86

Introduction to Recombinant Mouse EDA2R Protein

Recombinant Mouse EDA2R Protein, also known as Tumor Necrosis Factor Receptor Superfamily Member 27 (TNFRSF27), is a protein that plays a crucial role in the immune system. It is a member of the TNF receptor superfamily and is involved in various cellular processes, including cell survival, proliferation, and differentiation. This protein is produced through recombinant DNA technology, making it a valuable tool for scientific research and potential therapeutic applications.

Structure of Recombinant Mouse EDA2R Protein

The recombinant Mouse EDA2R Protein is a 33 kDa protein composed of 295 amino acids. It is a type I transmembrane protein, meaning it has a cytoplasmic tail, a transmembrane region, and an extracellular domain. The extracellular domain is where the protein interacts with its ligands, such as the cytokine EDA-A1, to initiate signaling pathways. The cytoplasmic tail contains a death domain, which is essential for the activation of downstream signaling molecules.

In addition, the recombinant Mouse EDA2R Protein has two isoforms, EDA2R-1 and EDA2R-2, which differ in their cytoplasmic tails. These isoforms have distinct functions and are expressed in different tissues and cell types. EDA2R-1 is mainly expressed in immune cells, while EDA2R-2 is found in non-immune cells.

Activity of Recombinant Mouse EDA2R Protein

The main function of recombinant Mouse EDA2R Protein is to act as a receptor for the cytokine EDA-A1, also known as Tumor Necrosis Factor-Like Ligand 1A (TL1A). Upon binding to EDA-A1, the protein undergoes a conformational change, leading to the recruitment of adaptor proteins and the activation of downstream signaling pathways.

One of the major signaling pathways activated by recombinant Mouse EDA2R Protein is the nuclear factor-kappa B (NF-κB) pathway. This pathway plays a crucial role in regulating immune responses, cell survival, and inflammation. Activation of the NF-κB pathway by recombinant Mouse EDA2R Protein leads to the production of pro-inflammatory cytokines and chemokines, which recruit immune cells to the site of inflammation.

In addition, recombinant Mouse EDA2R Protein has been shown to promote the survival and proliferation of immune cells, such as T cells and B cells, through the activation of the Akt and ERK signaling pathways. This suggests that the protein plays a crucial role in maintaining immune homeostasis and regulating immune cell function.

Applications of Recombinant Mouse EDA2R Protein

The recombinant Mouse EDA2R Protein has various potential applications in scientific research and therapeutic interventions. One of the main uses of this protein is in studying the role of EDA-A1/EDA2R signaling in immune responses and inflammation. By using recombinant Mouse EDA2R Protein, researchers can manipulate the signaling pathway and study its effects on immune cells and inflammatory processes.

In addition, recombinant Mouse EDA2R Protein has been investigated as a potential therapeutic target for autoimmune diseases and cancer. As the protein is involved in regulating immune responses, targeting it could modulate the activity of immune cells and reduce inflammation in autoimmune diseases. Moreover, inhibiting the function of recombinant Mouse EDA2R Protein has been shown to suppress the growth and survival of cancer cells, making it a potential target for cancer treatment.

In conclusion, recombinant Mouse EDA2R Protein is a valuable tool for understanding the role of EDA-A1/EDA2R signaling in the immune system and its potential applications in disease treatment. Its structure, activity, and applications make it a

Recombinant Mouse EDA2R Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse EDA2R Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products