Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CDC42 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P60766
Molecular weight:
23 kDa

Original price was: $282.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Met1–Cys188
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CDC42 Protein, N-His

Product name ARO-P10925-100
Uniprot ID P60766
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
Molecular weight 23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Cys188
Aliases /Synonyms CDC42, G25K GTP-binding protein, Cell division control protein 42 homolog
Reference ARO-P10925
Note For research use only.
Molecular Constructor
Met1–Cys188
Product name ARO-P10925-1MG
Uniprot ID P60766
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
Molecular weight 23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Cys188
Aliases /Synonyms CDC42, G25K GTP-binding protein, Cell division control protein 42 homolog
Reference ARO-P10925
Note For research use only.
Molecular Constructor
Met1–Cys188
Product name ARO-P10925-50
Uniprot ID P60766
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
Molecular weight 23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Cys188
Aliases /Synonyms CDC42, G25K GTP-binding protein, Cell division control protein 42 homolog
Reference ARO-P10925
Note For research use only.
Molecular Constructor
Met1–Cys188

Introduction

Recombinant Mouse CDC42 Protein is a highly conserved small GTPase that plays a crucial role in regulating various cellular processes such as cell growth, migration, and differentiation. It is a member of the Rho family of GTPases and is encoded by the Cdc42 gene in mice. Recombinant Mouse CDC42 Protein is widely used in research as an antigen for studying its structure and function, as well as its potential applications in disease treatment.

Structure of Recombinant Mouse CDC42 Protein

Recombinant Mouse CDC42 Protein is a 21 kDa protein composed of 191 amino acids. It has a characteristic three-dimensional structure consisting of a central beta sheet surrounded by alpha helices. The protein also contains a conserved GTP-binding domain, which is essential for its biological activity. Recombinant Mouse CDC42 Protein is highly homologous to its human counterpart, with a sequence identity of 92%.

Activity of Recombinant Mouse CDC42 Protein

Recombinant Mouse CDC42 Protein is a key regulator of the actin cytoskeleton and is involved in various cellular processes such as cell polarity, cell adhesion, and cell migration. It functions as a molecular switch, cycling between an inactive GDP-bound state and an active GTP-bound state. In its active form, Recombinant Mouse CDC42 Protein interacts with downstream effector proteins, leading to the reorganization of the actin cytoskeleton and the formation of filopodia and lamellipodia.

One of the major functions of Recombinant Mouse CDC42 Protein is its role in cell migration. It promotes the formation of filopodia at the leading edge of migrating cells, facilitating their movement. It also regulates the activity of focal adhesion kinase (FAK), a key player in cell adhesion and migration. Additionally, Recombinant Mouse CDC42 Protein is involved in the regulation of cell polarity, which is crucial for the proper development and function of many tissues and organs.

Applications of Recombinant Mouse CDC42 Protein

Recombinant Mouse CDC42 Protein has a wide range of applications in research, particularly in the fields of cell biology and biochemistry. It is commonly used as an antigen for studying its structure and function, as well as its interactions with other proteins. Recombinant Mouse CDC42 Protein can be produced in large quantities using recombinant DNA technology, making it easily accessible for research purposes.

One of the key applications of Recombinant Mouse CDC42 Protein is in the study of cell migration and its role in various diseases. Aberrant cell migration is a hallmark of many diseases, including cancer and neurodegenerative disorders. By studying the activity and function of Recombinant Mouse CDC42 Protein, researchers can gain insights into the mechanisms underlying these diseases and potentially develop new therapeutic strategies.

Recombinant Mouse CDC42 Protein is also used in drug discovery and development. As a key regulator of cell migration and cell adhesion, it is a potential target for drug development in diseases where these processes are dysregulated. Researchers can use Recombinant Mouse CDC42 Protein to screen for compounds that can modulate its activity and potentially lead to the development of new treatments.

Conclusion

In summary, Recombinant Mouse CDC42 Protein is a highly conserved small GTPase with a crucial role in regulating various cellular processes. Its structure and activity have been extensively studied, and it has a wide range of applications in research, particularly in the fields of cell biology and biochemistry. With its potential role in disease treatment, Recombinant Mouse CDC42 Protein continues to be a valuable tool for understanding the complex mechanisms of cellular function.

Recombinant Mouse CDC42 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CDC42 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products