Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CCL11/Eotaxin Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P48298
Molecular weight:
20.78 kDa

Original price was: $356.00.Current price is: $274.00.

50ug 23% OFF + 274 loyalty points
His24–Pro97
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CCL11/Eotaxin Protein, N-His-SUMO

Product name ARO-P10580-100
Uniprot ID P48298
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Molecular weight 20.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His24-Pro97
Aliases /Synonyms Small-inducible cytokine A11, SCYA11, Eotaxin, CCL11, Eosinophil chemotactic protein, C-C motif chemokine 11
Reference ARO-P10580
Note For research use only.
Molecular Constructor
His24–Pro97
Product name ARO-P10580-1MG
Uniprot ID P48298
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Molecular weight 20.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His24-Pro97
Aliases /Synonyms Small-inducible cytokine A11, SCYA11, Eotaxin, CCL11, Eosinophil chemotactic protein, C-C motif chemokine 11
Reference ARO-P10580
Note For research use only.
Molecular Constructor
His24–Pro97
Product name ARO-P10580-50
Uniprot ID P48298
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Molecular weight 20.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His24-Pro97
Aliases /Synonyms Small-inducible cytokine A11, SCYA11, Eotaxin, CCL11, Eosinophil chemotactic protein, C-C motif chemokine 11
Reference ARO-P10580
Note For research use only.
Molecular Constructor
His24–Pro97

Introduction

Recombinant Mouse CCL11/Eotaxin Protein, also known as Eotaxin-1, is a chemokine protein that plays a crucial role in the recruitment and activation of eosinophils, a type of white blood cell, in inflammatory responses. This protein is produced by various cell types, including endothelial cells, fibroblasts, and macrophages, and is involved in a wide range of physiological and pathological processes. In this article, we will delve into the structure, activity, and application of Recombinant Mouse CCL11/Eotaxin Protein.

Structure of Recombinant Mouse CCL11/Eotaxin Protein

Recombinant Mouse CCL11/Eotaxin Protein is a small protein consisting of 74 amino acids with a molecular weight of approximately 8.5 kDa. It belongs to the CC chemokine family, which is characterized by the presence of two adjacent cysteine residues near the amino terminus. These cysteine residues form a disulfide bond, which is essential for the protein’s stability and activity.

The protein has a highly conserved structure, with 60% sequence identity between human and mouse CCL11/Eotaxin. It also shares structural similarity with other CC chemokines, such as CCL2/MCP-1 and CCL3/MIP-1α. The crystal structure of Recombinant Mouse CCL11/Eotaxin Protein has been determined, revealing a three-dimensional structure with a beta-sheet core and a flexible N-terminal loop.

Activity of Recombinant Mouse CCL11/Eotaxin Protein

Recombinant Mouse CCL11/Eotaxin Protein is a potent chemoattractant for eosinophils, which are involved in the immune response against parasitic infections and allergic reactions. It binds to and activates the chemokine receptor CCR3, which is predominantly expressed on eosinophils and basophils. This binding triggers a cascade of signaling events, leading to the migration of these cells towards the site of inflammation.

Aside from its role in eosinophil recruitment, Recombinant Mouse CCL11/Eotaxin Protein also has pro-inflammatory effects. It can induce the production of other chemokines, such as CCL2/MCP-1 and CCL3/MIP-1α, by various cell types, including monocytes, macrophages, and fibroblasts. This further amplifies the inflammatory response and contributes to the recruitment of other immune cells.

Application of Recombinant Mouse CCL11/Eotaxin Protein

Due to its potent chemotactic and pro-inflammatory properties, Recombinant Mouse CCL11/Eotaxin Protein has been widely used in various research applications. It is commonly used to study the role of eosinophils in allergic diseases, such as asthma and atopic dermatitis. Recombinant Mouse CCL11/Eotaxin Protein is also used in studies investigating the mechanisms of eosinophil recruitment in parasitic infections.

In addition to its research applications, Recombinant Mouse CCL11/Eotaxin Protein has potential therapeutic applications. It has been shown to be effective in reducing eosinophilic inflammation in animal models of asthma and allergic rhinitis. Recombinant Mouse CCL11/Eotaxin Protein has also been investigated as a potential target for novel anti-inflammatory drugs.

Conclusion

Recombinant Mouse CCL11/Eotaxin Protein is a small chemokine protein that plays a crucial role in the recruitment and activation of eosinophils. It has a conserved structure with potent chemotactic and pro-inflammatory properties. This protein has been widely used in research studies and shows potential for therapeutic applications in various inflammatory conditions. Further research on Recombinant Mouse CCL11/Eotaxin Protein may provide valuable insights into its role in disease and potential therapeutic interventions.

Recombinant Mouse CCL11/Eotaxin Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse CCL11/Eotaxin Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products