Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse Ccl6 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P27784
Molecular weight:
20.77 kDa

Original price was: $312.00.Current price is: $274.00.

50ug 12% OFF + 274 loyalty points
Gln41–Ala116
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse Ccl6 Protein, N-His-SUMO

Product name ARO-P11043-100
Uniprot ID P27784
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVI
Molecular weight 20.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln41-Ala116
Aliases /Synonyms Protein C10, C10, Scya6, Ccl6, Small-inducible cytokine A6, C-C motif chemokine 6
Reference ARO-P11043
Note For research use only.
Molecular Constructor
Gln41–Ala116
Product name ARO-P11043-1MG
Uniprot ID P27784
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVI
Molecular weight 20.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln41-Ala116
Aliases /Synonyms Protein C10, C10, Scya6, Ccl6, Small-inducible cytokine A6, C-C motif chemokine 6
Reference ARO-P11043
Note For research use only.
Molecular Constructor
Gln41–Ala116
Product name ARO-P11043-50
Uniprot ID P27784
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVI
Molecular weight 20.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln41-Ala116
Aliases /Synonyms Protein C10, C10, Scya6, Ccl6, Small-inducible cytokine A6, C-C motif chemokine 6
Reference ARO-P11043
Note For research use only.
Molecular Constructor
Gln41–Ala116

Introduction to Recombinant Mouse Ccl6 Protein

Recombinant Mouse Ccl6 Protein, also known as Chemokine (C-C motif) ligand 6, is a small cytokine protein that plays a crucial role in the immune response and inflammation. It is a member of the C-C chemokine family and is produced by various cell types, including macrophages, fibroblasts, and endothelial cells. Recombinant Mouse Ccl6 Protein is a highly conserved protein, with a molecular weight of approximately 8 kDa.

Structure of Recombinant Mouse Ccl6 Protein

The structure of Recombinant Mouse Ccl6 Protein consists of 107 amino acids, with a conserved cysteine motif at the N-terminus and a highly conserved C-terminal region. It contains four cysteine residues, which form two disulfide bonds, giving it a characteristic tertiary structure. The protein also has a characteristic beta-sheet and alpha-helix secondary structure, which is essential for its function as a chemokine.

Activity of Recombinant Mouse Ccl6 Protein

Recombinant Mouse Ccl6 Protein acts as a chemoattractant for various immune cells, including monocytes, macrophages, dendritic cells, and T cells. It binds to the chemokine receptor CCR1, which is expressed on the surface of these cells, and induces their migration towards the site of inflammation or infection. This recruitment of immune cells is crucial for the initiation and progression of the immune response.

In addition to its chemotactic activity, Recombinant Mouse Ccl6 Protein also has pro-inflammatory properties. It can stimulate the production of pro-inflammatory cytokines, such as interleukin-1 (IL-1) and tumor necrosis factor-alpha (TNF-α), by immune cells. This further amplifies the immune response and helps in the clearance of pathogens or damaged cells.

Application of Recombinant Mouse Ccl6 Protein

Recombinant Mouse Ccl6 Protein has various applications in both research and therapeutic settings. One of its primary uses is in the study of immune responses and inflammation. Its ability to induce the migration of immune cells makes it a valuable tool for investigating the role of these cells in different diseases, such as autoimmune disorders, allergies, and infections.

In therapeutic settings, Recombinant Mouse Ccl6 Protein has shown potential as an anti-cancer agent. Studies have demonstrated that it can inhibit the growth and metastasis of certain types of cancer cells, including breast and prostate cancer. This is due to its ability to induce the recruitment of immune cells, which can then target and destroy cancer cells.

Furthermore, Recombinant Mouse Ccl6 Protein has also been studied for its potential use in the treatment of inflammatory diseases, such as rheumatoid arthritis and multiple sclerosis. Its ability to stimulate the production of pro-inflammatory cytokines can be beneficial in these conditions, where the immune response is dysregulated.

Conclusion

Recombinant Mouse Ccl6 Protein is a vital cytokine in the immune system, with both chemotactic and pro-inflammatory properties. Its structure and activity make it an essential molecule in the initiation and progression of the immune response. Its diverse applications in research and therapy make it a valuable tool in understanding and treating various diseases. Further studies on Recombinant Mouse Ccl6 Protein may lead to the development of novel treatments for immune and inflammatory disorders.

Recombinant Mouse Ccl6 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse Ccl6 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products