Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse FRZB Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P97401
Molecular weight:
12.87 kDa

Original price was: $315.00.Current price is: $274.00.

50ug 13% OFF + 274 loyalty points
Thr186–Lys277
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse FRZB Protein, N-His

Product name ARO-P11097-100
Uniprot ID P97401
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEILKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEK
Molecular weight 12.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr186-Lys277
Aliases /Synonyms Frzb, Frezzled, sFRP-3, Fre, Frzb1, Secreted frizzled-related protein 3, Frizzled-related protein 1, Sfrp3, Fiz, Fritz, FrzB-1
Reference ARO-P11097
Note For research use only.
Molecular Constructor
Thr186–Lys277
Product name ARO-P11097-1MG
Uniprot ID P97401
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEILKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEK
Molecular weight 12.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr186-Lys277
Aliases /Synonyms Frzb, Frezzled, sFRP-3, Fre, Frzb1, Secreted frizzled-related protein 3, Frizzled-related protein 1, Sfrp3, Fiz, Fritz, FrzB-1
Reference ARO-P11097
Note For research use only.
Molecular Constructor
Thr186–Lys277
Product name ARO-P11097-50
Uniprot ID P97401
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEILKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEK
Molecular weight 12.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr186-Lys277
Aliases /Synonyms Frzb, Frezzled, sFRP-3, Fre, Frzb1, Secreted frizzled-related protein 3, Frizzled-related protein 1, Sfrp3, Fiz, Fritz, FrzB-1
Reference ARO-P11097
Note For research use only.
Molecular Constructor
Thr186–Lys277

Recombinant Mouse FRZB Protein, also known as Frizzled-related protein, is a secreted glycoprotein that plays a crucial role in the regulation of bone and joint development. It is a member of the frizzled-related protein family, which are antagonists of the Wnt signaling pathway. The Wnt signaling pathway is involved in various cellular processes, including cell proliferation, differentiation, and migration. Dysregulation of this pathway has been linked to various diseases, making FRZB a potential therapeutic target.

Structure of Recombinant Mouse FRZB Protein

The recombinant form of FRZB protein is produced through genetic engineering techniques, using mammalian cell lines. It is a 32 kDa protein with a conserved cysteine-rich domain and a frizzled-like cysteine-rich domain. The cysteine-rich domains are essential for the binding of FRZB to Wnt ligands, thus inhibiting the activation of the Wnt signaling pathway. The protein also contains a signal peptide, which allows for its secretion from cells.

Activity of Recombinant Mouse FRZB Protein

The main function of FRZB protein is to regulate the activity of the Wnt signaling pathway. It does so by binding to Wnt ligands and preventing their interaction with frizzled receptors on the cell surface. This interaction blocks the downstream signaling events, leading to the inhibition of the Wnt pathway. This activity of FRZB is crucial for the proper development and maintenance of bone and joint tissues. Studies have also shown that FRZB can inhibit the growth and migration of cancer cells by blocking the Wnt signaling pathway.

Application of Recombinant Mouse FRZB Protein

Due to its role in regulating the Wnt signaling pathway, recombinant mouse FRZB protein has potential applications in various fields, including bone and joint disorders, cancer, and tissue engineering.

Bone and Joint Disorders

FRZB protein has been extensively studied in relation to bone and joint disorders, such as osteoarthritis and osteoporosis. Osteoarthritis is a degenerative joint disease characterized by the breakdown of cartilage and bone in the joints. Studies have shown that FRZB levels are decreased in osteoarthritic joints, leading to increased Wnt signaling and cartilage degradation. Recombinant FRZB protein has been shown to inhibit the Wnt signaling pathway and protect against cartilage breakdown, making it a potential therapeutic agent for osteoarthritis.

Osteoporosis, on the other hand, is a disease characterized by reduced bone density and increased risk of fractures. FRZB has been shown to regulate bone formation and resorption, making it a potential target for the treatment of osteoporosis. Recombinant FRZB protein has been shown to increase bone formation and decrease bone resorption, making it a promising candidate for the development of osteoporosis treatments.

Cancer

The dysregulation of the Wnt signaling pathway has been linked to the development and progression of various cancers. FRZB protein, by inhibiting the Wnt pathway, has been shown to have anti-tumor effects in various cancer types. Recombinant FRZB protein has been studied as a potential therapeutic agent for cancer, either alone or in combination with other treatments. It has been shown to inhibit tumor growth and metastasis, making it a promising candidate for cancer therapy.

Tissue Engineering

FRZB protein has also been studied for its potential use in tissue engineering. Its ability to regulate cell proliferation and differentiation makes it a valuable tool for the development of tissue-engineered bone and cartilage. Recombinant FRZB protein has been incorporated into scaffolds for bone and cartilage tissue engineering, showing promising results in promoting tissue regeneration.

Conclusion</

Recombinant Mouse FRZB Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse FRZB Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products