Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD125/IL5RA Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P21183
Molecular weight:
36.14 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Asn32–Gly329
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD125/IL5RA Protein, N-His

Product name ARO-P10601-100
Uniprot ID P21183
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVG
Molecular weight 36.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn32-Gly329
Aliases /Synonyms IL-5R subunit alpha, IL-5 receptor subunit alpha, IL5RA, IL-5RA, IL-5R-alpha, Interleukin-5 receptor subunit alpha, CDw125, CD125, IL5R
Reference ARO-P10601
Note For research use only.
Molecular Constructor
Asn32–Gly329
Product name ARO-P10601-1MG
Uniprot ID P21183
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVG
Molecular weight 36.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn32-Gly329
Aliases /Synonyms IL-5R subunit alpha, IL-5 receptor subunit alpha, IL5RA, IL-5RA, IL-5R-alpha, Interleukin-5 receptor subunit alpha, CDw125, CD125, IL5R
Reference ARO-P10601
Note For research use only.
Molecular Constructor
Asn32–Gly329
Product name ARO-P10601-50
Uniprot ID P21183
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVG
Molecular weight 36.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn32-Gly329
Aliases /Synonyms IL-5R subunit alpha, IL-5 receptor subunit alpha, IL5RA, IL-5RA, IL-5R-alpha, Interleukin-5 receptor subunit alpha, CDw125, CD125, IL5R
Reference ARO-P10601
Note For research use only.
Molecular Constructor
Asn32–Gly329

Introduction

Recombinant Mouse CD125/IL5RA Protein, also known as Interleukin-5 Receptor Alpha (IL5RA), is a protein that plays a crucial role in the immune system. It is a type I transmembrane protein that is expressed on the surface of various immune cells, including B cells, T cells, and eosinophils. This protein is encoded by the IL5RA gene and is involved in the binding and signaling of Interleukin-5 (IL-5), a cytokine that regulates the growth and differentiation of eosinophils and other immune cells.

Structure of Recombinant Mouse CD125/IL5RA Protein

The Recombinant Mouse CD125/IL5RA Protein is a 60 kDa protein that consists of 443 amino acids. It has a single transmembrane domain, a short cytoplasmic tail, and a large extracellular domain. The extracellular domain contains several conserved regions, including a cytokine receptor homology domain (CRH), a fibronectin type III domain, and a WSXWS motif. These regions are important for ligand binding and signal transduction.

Activity of Recombinant Mouse CD125/IL5RA Protein

The main function of Recombinant Mouse CD125/IL5RA Protein is to bind to IL-5 and initiate downstream signaling pathways. IL-5 binds to the CRH domain of the protein, leading to the dimerization of IL5RA with the IL-5 receptor beta subunit (IL-5RB). This dimerization activates the Janus kinase/signal transducer and activator of transcription (JAK/STAT) pathway, resulting in the phosphorylation of STAT5 and the induction of gene transcription. This signaling pathway is crucial for the survival, proliferation, and activation of eosinophils, which play a role in allergic and inflammatory responses.

In addition to its role in IL-5 signaling, Recombinant Mouse CD125/IL5RA Protein has also been shown to interact with other cytokines, such as IL-3 and granulocyte-macrophage colony-stimulating factor (GM-CSF). This interaction can modulate the activity of IL-5 and enhance the survival and activation of eosinophils and other immune cells.

Application of Recombinant Mouse CD125/IL5RA Protein

Recombinant Mouse CD125/IL5RA Protein has a wide range of applications in both research and clinical settings. In research, this protein is commonly used as an antigen to study the structure and function of IL-5 and its receptor. It is also used to investigate the role of IL-5 signaling in various diseases, including asthma, allergies, and parasitic infections.

In clinical settings, Recombinant Mouse CD125/IL5RA Protein has potential therapeutic applications. As IL-5 is a key cytokine involved in the development and maintenance of eosinophilic disorders, targeting the IL-5/IL5RA signaling pathway has been explored as a treatment option. Recombinant Mouse CD125/IL5RA Protein can be used to block IL-5 signaling and inhibit the survival and activation of eosinophils. This approach has shown promising results in clinical trials for the treatment of severe asthma and eosinophilic disorders, such as eosinophilic esophagitis and hypereosinophilic syndrome.

Conclusion

In summary, Recombinant Mouse CD125/IL5RA Protein is a crucial protein involved in the immune system, specifically in the binding and signaling of IL-5. Its structure, activity, and applications have been extensively studied and have provided valuable insights into the role of IL-5 signaling in various diseases. With its potential therapeutic applications, this protein continues to be a subject of interest for researchers and clinicians alike.

Recombinant Mouse CD125/IL5RA Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD125/IL5RA Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products