Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD204/MSR1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P30204
Molecular weight:
13.61 kDa

Original price was: $396.00.Current price is: $327.00.

100ug 17% OFF + 327 loyalty points
Thr356–Ser458
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD204/MSR1 Protein, N-His

Product name ARO-P11022-100
Uniprot ID P30204
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVRLVGGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIWLNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
Molecular weight 13.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr356-Ser458
Aliases /Synonyms CD204, Macrophage acetylated LDL receptor I and II, Scvr, Scavenger receptor type A, Msr1, Macrophage scavenger receptor types I and II, SR-A
Reference ARO-P11022
Note For research use only.
Molecular Constructor
Thr356–Ser458
Product name ARO-P11022-1MG
Uniprot ID P30204
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVRLVGGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIWLNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
Molecular weight 13.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr356-Ser458
Aliases /Synonyms CD204, Macrophage acetylated LDL receptor I and II, Scvr, Scavenger receptor type A, Msr1, Macrophage scavenger receptor types I and II, SR-A
Reference ARO-P11022
Note For research use only.
Molecular Constructor
Thr356–Ser458
Product name ARO-P11022-50
Uniprot ID P30204
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVRLVGGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIWLNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
Molecular weight 13.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr356-Ser458
Aliases /Synonyms CD204, Macrophage acetylated LDL receptor I and II, Scvr, Scavenger receptor type A, Msr1, Macrophage scavenger receptor types I and II, SR-A
Reference ARO-P11022
Note For research use only.
Molecular Constructor
Thr356–Ser458

Introduction to Recombinant Mouse CD204/MSR1 Protein

Recombinant Mouse CD204/MSR1 Protein, also known as Macrophage Scavenger Receptor 1 (MSR1), is a type I transmembrane protein that belongs to the class A scavenger receptor family. It is primarily expressed on the surface of macrophages, but can also be found on dendritic cells and some types of endothelial cells. This protein plays a crucial role in the innate immune response by recognizing and binding to a variety of ligands, including modified lipoproteins, bacteria, and apoptotic cells.

Structure of Recombinant Mouse CD204/MSR1 Protein

The Recombinant Mouse CD204/MSR1 Protein is composed of 4 domains: a cytoplasmic domain, a transmembrane domain, a spacer domain, and an extracellular domain. The extracellular domain contains a cysteine-rich domain and a collagen-like domain, which are responsible for ligand binding. The cytoplasmic domain contains a conserved NPXY motif, which is involved in signal transduction and endocytosis. The transmembrane domain anchors the protein to the cell membrane, while the spacer domain connects the extracellular and transmembrane domains.

Activity of Recombinant Mouse CD204/MSR1 Protein

The main function of Recombinant Mouse CD204/MSR1 Protein is to act as a scavenger receptor, which is responsible for the recognition and uptake of a wide range of ligands. This protein is capable of binding to various types of modified lipoproteins, such as oxidized low-density lipoprotein (oxLDL), which are often present in atherosclerotic plaques. It also has the ability to bind to bacteria, such as Gram-positive and Gram-negative bacteria, and facilitate their phagocytosis and clearance by macrophages. In addition, Recombinant Mouse CD204/MSR1 Protein can recognize and bind to apoptotic cells, promoting their clearance and preventing the release of pro-inflammatory cytokines.

Moreover, Recombinant Mouse CD204/MSR1 Protein has been shown to play a role in regulating immune responses by modulating the production of cytokines and chemokines. It can also activate signaling pathways, such as the NF-κB pathway, which are involved in the inflammatory response. This protein has been found to be upregulated in various inflammatory conditions, suggesting its important role in immune regulation.

Application of Recombinant Mouse CD204/MSR1 Protein

Due to its diverse ligand binding capabilities and immune regulatory functions, Recombinant Mouse CD204/MSR1 Protein has been widely used in various research applications. One of its main applications is in the study of atherosclerosis, as this protein is involved in the uptake of modified lipoproteins, a key process in the development of this disease. Recombinant Mouse CD204/MSR1 Protein has also been used in studies related to bacterial infections, as it plays a role in the clearance of bacteria by macrophages.

Furthermore, Recombinant Mouse CD204/MSR1 Protein has potential therapeutic applications. Its ability to modulate immune responses makes it a potential target for the treatment of inflammatory diseases, such as atherosclerosis and sepsis. In addition, this protein has been studied for its potential role in cancer immunotherapy, as it has been found to be involved in the recognition and clearance of tumor cells by macrophages.

Conclusion

In summary, Recombinant Mouse CD204/MSR1 Protein is a crucial component of the innate immune system, with important roles in ligand recognition, phagocytosis, and immune regulation. Its diverse functions make it a valuable tool in research and a potential target for therapeutic interventions. Further studies on this protein may provide insights into its role in

Recombinant Mouse CD204/MSR1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD204/MSR1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products