Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD319/SLAMF7 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q8BHK6
Molecular weight:
24.62 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Ala22–Gly224
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD319/SLAMF7 Protein, N-His

Product name ARO-P10506-100
Uniprot ID Q8BHK6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ASGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSLRG
Molecular weight 24.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala22-Gly224
Aliases /Synonyms SLAMF7, CRACC, Protein 19A, SLAM family member 7, CD2-like receptor-activating cytotoxic cells, Membrane protein FOAP-12, CD319, Novel Ly9, CD2 subset 1, CS1
Reference ARO-P10506
Note For research use only.
Molecular Constructor
Ala22–Gly224
Product name ARO-P10506-1MG
Uniprot ID Q8BHK6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ASGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSLRG
Molecular weight 24.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala22-Gly224
Aliases /Synonyms SLAMF7, CRACC, Protein 19A, SLAM family member 7, CD2-like receptor-activating cytotoxic cells, Membrane protein FOAP-12, CD319, Novel Ly9, CD2 subset 1, CS1
Reference ARO-P10506
Note For research use only.
Molecular Constructor
Ala22–Gly224
Product name ARO-P10506-50
Uniprot ID Q8BHK6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ASGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSLRG
Molecular weight 24.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala22-Gly224
Aliases /Synonyms SLAMF7, CRACC, Protein 19A, SLAM family member 7, CD2-like receptor-activating cytotoxic cells, Membrane protein FOAP-12, CD319, Novel Ly9, CD2 subset 1, CS1
Reference ARO-P10506
Note For research use only.
Molecular Constructor
Ala22–Gly224

Introduction

Recombinant Mouse CD319/SLAMF7 Protein, also known as signaling lymphocytic activation molecule family member 7, is a type I transmembrane glycoprotein that belongs to the SLAM family of cell surface receptors. It is encoded by the SLAMF7 gene and is expressed on the surface of various immune cells, including natural killer (NK) cells, T cells, and B cells. This protein plays a crucial role in immune cell activation and regulation, making it a valuable target for research and therapeutic applications.

Structure

Recombinant Mouse CD319/SLAMF7 Protein is a 335 amino acid protein with a predicted molecular weight of approximately 38 kDa. It contains a single extracellular domain, a transmembrane domain, and a cytoplasmic tail. The extracellular domain is composed of two immunoglobulin-like domains, a V-set domain and a C2-set domain, which are responsible for ligand binding and receptor signaling. The cytoplasmic tail contains two tyrosine-based signaling motifs, which are essential for downstream signaling events.

Activity

Recombinant Mouse CD319/SLAMF7 Protein is a cell surface receptor that interacts with various ligands, including itself, to regulate immune cell functions. Upon ligand binding, CD319/SLAMF7 undergoes homophilic or heterophilic interactions with other SLAM family members, leading to the activation of downstream signaling pathways. This results in the activation of immune cells and the production of pro-inflammatory cytokines, such as interferon-gamma and tumor necrosis factor-alpha.

In addition to its role in immune cell activation, CD319/SLAMF7 has been shown to play a critical role in regulating immune cell migration and adhesion. It has been reported that this protein can mediate the adhesion of NK cells to target cells, promoting their cytotoxic activity. It can also regulate the migration of T cells and B cells to sites of inflammation, contributing to the immune response.

Application

Recombinant Mouse CD319/SLAMF7 Protein has a wide range of applications in both research and therapeutic settings. In research, this protein is commonly used as an antigen to study the function and regulation of immune cells. Its ability to activate immune cells and induce cytokine production makes it a valuable tool for studying immune responses and inflammatory diseases.

In therapeutic applications, CD319/SLAMF7 has been identified as a potential target for the treatment of various diseases, including cancer and autoimmune disorders. It has been reported that this protein is highly expressed on the surface of multiple myeloma cells, making it a promising target for immunotherapy. Several clinical trials are currently underway to evaluate the efficacy of targeting CD319/SLAMF7 in the treatment of multiple myeloma and other cancers.

Furthermore, CD319/SLAMF7 has been implicated in the pathogenesis of autoimmune diseases, such as systemic lupus erythematosus and rheumatoid arthritis. Targeting this protein has shown promising results in preclinical studies, and clinical trials are ongoing to evaluate its potential as a therapeutic target for these diseases.

Conclusion

Recombinant Mouse CD319/SLAMF7 Protein is a crucial player in immune cell activation, regulation, and migration. Its structure and activity make it a valuable tool for research and a promising target for therapeutic interventions. With ongoing research and clinical trials, this protein has the potential to contribute significantly to the understanding and treatment of various diseases.

Recombinant Mouse CD319/SLAMF7 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD319/SLAMF7 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products