Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CST3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P21460
Molecular weight:
13.51 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Gly42–Ala140
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CST3 Protein, N-His

Product name ARO-P11025-100
Uniprot ID P21460
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
Molecular weight 13.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly42-Ala140
Aliases /Synonyms Cystatin-C, Cst3, Cystatin-3
Reference ARO-P11025
Note For research use only.
Molecular Constructor
Gly42–Ala140
Product name ARO-P11025-1MG
Uniprot ID P21460
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
Molecular weight 13.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly42-Ala140
Aliases /Synonyms Cystatin-C, Cst3, Cystatin-3
Reference ARO-P11025
Note For research use only.
Molecular Constructor
Gly42–Ala140
Product name ARO-P11025-50
Uniprot ID P21460
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
Molecular weight 13.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly42-Ala140
Aliases /Synonyms Cystatin-C, Cst3, Cystatin-3
Reference ARO-P11025
Note For research use only.
Molecular Constructor
Gly42–Ala140

Introduction

Recombinant Mouse CST3 Protein, also known as cystatin C, is a protein that plays a critical role in regulating protease activity and maintaining tissue homeostasis. This protein is highly conserved among species and has been extensively studied for its structure, activity, and potential applications. In this article, we will explore the various aspects of Recombinant Mouse CST3 Protein, from its structure and function to its potential as an antigen for research and therapeutic purposes.

Structure of Recombinant Mouse CST3 Protein

Recombinant Mouse CST3 Protein is a small, 13-kDa protein composed of 120 amino acids. It belongs to the cystatin superfamily, which includes cystatins A, B, C, D, E, F, G, S, SN, and SA. The protein has a conserved N-terminal segment that is responsible for its inhibitory activity against cysteine proteases, and a less conserved C-terminal segment that is involved in protein-protein interactions. The crystal structure of Recombinant Mouse CST3 Protein has been determined, revealing a compact, globular structure with a four-stranded anti-parallel beta-sheet and an alpha-helix. This structure allows for the protein to effectively inhibit cysteine proteases by forming a reversible complex with the enzyme.

Activity of Recombinant Mouse CST3 Protein

Recombinant Mouse CST3 Protein is a potent inhibitor of cysteine proteases, including cathepsins B, H, K, L, and S. It works by binding to the active site of these enzymes, preventing them from degrading proteins and maintaining tissue integrity. In addition to its inhibitory activity, Recombinant Mouse CST3 Protein also has anti-inflammatory and anti-oxidant properties. It has been shown to inhibit the production of pro-inflammatory cytokines and to protect against oxidative stress. These activities make Recombinant Mouse CST3 Protein a promising therapeutic agent for various diseases, such as neurodegenerative disorders, cancer, and cardiovascular diseases.

Applications of Recombinant Mouse CST3 Protein

Recombinant Mouse CST3 Protein has a wide range of applications in both research and therapeutic settings. As a potent inhibitor of cysteine proteases, it is commonly used as a tool to study the role of these enzymes in various biological processes. It is also used as a biomarker for kidney function, as its levels in the blood can reflect glomerular filtration rate. In addition, Recombinant Mouse CST3 Protein has shown potential as a therapeutic agent for neurodegenerative diseases, such as Alzheimer’s and Parkinson’s, due to its ability to inhibit the formation of amyloid-beta and alpha-synuclein aggregates, respectively. It has also been studied for its potential in cancer therapy, as it can inhibit tumor growth and metastasis by targeting cathepsins involved in these processes.

Recombinant Mouse CST3 Protein as an Antigen

Recombinant proteins, including Recombinant Mouse CST3 Protein, can be used as antigens to generate specific antibodies for research and diagnostic purposes. The recombinant protein is expressed in a heterologous system, such as E. coli or yeast, and purified to high levels of purity. This allows for the production of large quantities of the protein, which can then be used to immunize animals and generate monoclonal or polyclonal antibodies. These antibodies can then be used in various techniques, such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA), to study the expression and localization of Recombinant Mouse CST3 Protein in different tissues and cell types.

Conclusion

In conclusion, Recombinant Mouse CST3 Protein is a highly conserved, 13-kDa protein with a compact, globular structure. It is a potent inhibitor of cysteine proteases and has anti-inflammatory and anti-oxidant properties. This protein has a wide range of applications in research and therapeutics

Recombinant Mouse CST3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CST3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products