Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CTSB Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P10605
Molecular weight:
33.75 kDa

Original price was: $466.00.Current price is: $392.00.

100ug 16% OFF + 392 loyalty points
Asp51–Phe339
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CTSB Protein, N-His

Product name ARO-P11106-100
Uniprot ID P10605
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRF
Molecular weight 33.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp51-Phe339
Aliases /Synonyms Cathepsin B, Ctsb, Cathepsin B1
Reference ARO-P11106
Note For research use only.
Molecular Constructor
Asp51–Phe339
Product name ARO-P11106-1MG
Uniprot ID P10605
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRF
Molecular weight 33.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp51-Phe339
Aliases /Synonyms Cathepsin B, Ctsb, Cathepsin B1
Reference ARO-P11106
Note For research use only.
Molecular Constructor
Asp51–Phe339
Product name ARO-P11106-50
Uniprot ID P10605
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRF
Molecular weight 33.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp51-Phe339
Aliases /Synonyms Cathepsin B, Ctsb, Cathepsin B1
Reference ARO-P11106
Note For research use only.
Molecular Constructor
Asp51–Phe339

Introduction

Recombinant Mouse CTSB Protein is a synthetic form of the cathepsin B enzyme, which is found in the lysosomes of mammalian cells. This protein is produced through genetic engineering techniques, making it a valuable tool for various research and diagnostic applications. In this article, we will delve into the structure, activity, and potential applications of this recombinant protein.

Structure of Recombinant Mouse CTSB Protein

The recombinant mouse CTSB protein is a 32 kDa protein consisting of 339 amino acids. It has a highly conserved structure, with 87% sequence identity to the human cathepsin B enzyme. The protein contains a signal peptide, propeptide, and mature enzyme domain. The signal peptide is responsible for targeting the protein to the lysosomes, while the propeptide acts as an inhibitor of the enzyme until it is activated in the acidic environment of the lysosomes.

The mature enzyme domain is the active form of the protein and contains the catalytic site responsible for the cleavage of peptide bonds. This domain also contains a cysteine residue, which is essential for the enzymatic activity of cathepsin B. The recombinant protein is produced in a variety of expression systems, including bacteria, yeast, and mammalian cells, to obtain high yields of active protein.

Activity of Recombinant Mouse CTSB Protein

Recombinant mouse CTSB protein is a cysteine protease that plays a crucial role in protein degradation and processing in the lysosomes. It is involved in the breakdown of proteins, including extracellular matrix proteins, and also plays a role in antigen presentation. The enzyme is activated in the acidic environment of the lysosomes, where it cleaves peptide bonds and degrades proteins into smaller peptides and amino acids.

The activity of recombinant mouse CTSB protein can be measured using various biochemical assays, including fluorometric and colorimetric assays. These assays utilize synthetic substrates that are cleaved by the enzyme, resulting in a fluorescent or colorimetric signal that can be quantified. The activity of the protein can also be inhibited by specific inhibitors, such as E-64, which binds to the active site of the enzyme.

Applications of Recombinant Mouse CTSB Protein

The recombinant mouse CTSB protein has a wide range of applications in research and diagnostics. Its ability to cleave peptide bonds and degrade proteins makes it a valuable tool for studying protein-protein interactions, protein processing, and protein degradation pathways. The enzyme is also involved in the immune response, making it a potential target for drug development.

One of the major applications of recombinant mouse CTSB protein is in the field of cancer research. Elevated levels of cathepsin B have been observed in various types of cancer, and the recombinant protein can be used to study its role in tumor growth and metastasis. The enzyme has also been linked to neurodegenerative diseases, and its activity can be studied using recombinant protein in disease models.

In addition to research, recombinant mouse CTSB protein is also used in diagnostics. Elevated levels of cathepsin B have been associated with various diseases, and the enzyme can be used as a biomarker for disease diagnosis and prognosis. The recombinant protein can be used in diagnostic kits to detect the presence of cathepsin B in biological samples, such as blood or tissue samples.

Conclusion

Recombinant Mouse CTSB Protein is a valuable tool for studying protein degradation, processing, and immune response. Its highly conserved structure and enzymatic activity make it a reliable and versatile protein for various research and diagnostic applications. With ongoing research and advancements in genetic engineering techniques, the use of recombinant CTSB protein is expected to increase in the future, leading to a better understanding of

Recombinant Mouse CTSB Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CTSB Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products