Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse GDF15/MIC1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9Z0J7
Molecular weight:
23.47 kDa

Original price was: $303.00.Current price is: $274.00.

50ug 10% OFF + 274 loyalty points
Gly203–Ala303
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse GDF15/MIC1 Protein, N-His-SUMO

Product name ARO-P11108-100
Uniprot ID Q9Z0J7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA
Molecular weight 23.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly203-Ala303
Aliases /Synonyms Mic1, GDF-15, Sbf, Growth/differentiation factor 15, Macrophage inhibitory cytokine 1, Gdf15, MIC-1
Reference ARO-P11108
Note For research use only.
Molecular Constructor
Gly203–Ala303
Product name ARO-P11108-1MG
Uniprot ID Q9Z0J7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA
Molecular weight 23.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly203-Ala303
Aliases /Synonyms Mic1, GDF-15, Sbf, Growth/differentiation factor 15, Macrophage inhibitory cytokine 1, Gdf15, MIC-1
Reference ARO-P11108
Note For research use only.
Molecular Constructor
Gly203–Ala303
Product name ARO-P11108-50
Uniprot ID Q9Z0J7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA
Molecular weight 23.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly203-Ala303
Aliases /Synonyms Mic1, GDF-15, Sbf, Growth/differentiation factor 15, Macrophage inhibitory cytokine 1, Gdf15, MIC-1
Reference ARO-P11108
Note For research use only.
Molecular Constructor
Gly203–Ala303

Introduction

Recombinant Mouse GDF15/MIC1 Protein is a highly versatile and biologically active protein that has gained significant attention in the scientific community. This protein is a member of the TGF-β superfamily and is encoded by the GDF15 gene in mice. It is also known as Macrophage Inhibitory Cytokine 1 (MIC1) and Placental Transforming Growth Factor (PTGF). Recombinant Mouse GDF15/MIC1 Protein is a valuable tool for researchers and has a wide range of applications in various fields of biology and medicine.

Structure

Recombinant Mouse GDF15/MIC1 Protein is a homodimeric protein, meaning it is composed of two identical subunits. Each subunit is approximately 40 kDa in size and consists of 112 amino acids. The structure of this protein is highly conserved across different species, with 80% sequence identity between mouse and human GDF15. The crystal structure of Recombinant Mouse GDF15/MIC1 Protein has been determined, revealing a characteristic cystine knot fold, which is a common feature among TGF-β superfamily members.

Activity

Recombinant Mouse GDF15/MIC1 Protein plays a crucial role in various biological processes, including cell growth, differentiation, and apoptosis. It exerts its effects by binding to specific cell surface receptors, such as the Activin receptor-like kinase (ALK) receptors and the Type I and Type II TGF-β receptors. This binding activates downstream signaling pathways, including the SMAD pathway, which regulates gene expression and cellular responses.

One of the main activities of Recombinant Mouse GDF15/MIC1 Protein is its anti-inflammatory and immunosuppressive effects. It has been shown to inhibit the production of pro-inflammatory cytokines and chemokines, as well as the activation of immune cells, such as macrophages and T cells. This makes it a potential therapeutic target for various inflammatory diseases.

Application

Recombinant Mouse GDF15/MIC1 Protein has a wide range of applications in both basic research and clinical settings. Some of its key applications include:

Stem Cell Research

Recombinant Mouse GDF15/MIC1 Protein has been shown to promote the differentiation of embryonic stem cells into cardiomyocytes, making it a valuable tool for studying heart development and disease. It has also been used to induce the differentiation of mesenchymal stem cells into osteoblasts, which has potential applications in bone tissue engineering and regenerative medicine.

Cancer Research

Recombinant Mouse GDF15/MIC1 Protein has been implicated in various types of cancer, including breast, prostate, and pancreatic cancer. It has been shown to inhibit the growth and survival of cancer cells, making it a potential anti-cancer agent. In addition, it has been used as a biomarker for cancer diagnosis and prognosis.

Metabolic Disorders

Recombinant Mouse GDF15/MIC1 Protein has been linked to metabolic disorders, such as obesity, diabetes, and cardiovascular diseases. It has been shown to regulate energy metabolism and body weight, making it a potential therapeutic target for these conditions.

Inflammatory Diseases

Recombinant Mouse GDF15/MIC1 Protein has anti-inflammatory and immunosuppressive effects, making it a potential treatment for various inflammatory diseases, such as rheumatoid arthritis, inflammatory bowel disease, and multiple sclerosis.

Diagnostic Tool

Recombinant Mouse GDF15/MIC1 Protein has been used as a diagnostic marker for various diseases. Its levels have been found to be altered in conditions such as heart failure, chronic kidney disease, and preeclampsia, making it a potential biomarker for disease diagnosis and monitoring.

Conclusion

In summary, Recombinant Mouse GDF15/MIC1 Protein is a highly versatile and bi

Recombinant Mouse GDF15/MIC1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse GDF15/MIC1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products