Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Mouse CD48 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P18181
Molecular weight:
39.34 kDa

Original price was: $287.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Asp30–Val124
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Mouse CD48 Protein, N-GST & C-His

Recombinant Mouse CD48 Protein, N-GST & C-His

Product name ARO-P10555-100
Uniprot ID P18181
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DINATTGSNVTLKIHKDPLGPYKRITWLHTKNQKILEYNYNSTKTIFESEFKGRVYLEENNGALHISNVRKEDKGTYYMRVLRETENELKITLEV
Molecular weight 39.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp30-Val124
Aliases /Synonyms Signaling lymphocytic activation molecule 2, TCT.1, CD48 antigen, B-lymphocyte activation marker BLAST-1, BCM1, CD48, BLAST1, Leukocyte antigen MEM-102, SLAMF2, BCM1 surface antigen, SLAM family member 2
Reference ARO-P10555
Note For research use only.
Molecular Constructor
Asp30–Val124
Product name ARO-P10555-1MG
Uniprot ID P18181
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DINATTGSNVTLKIHKDPLGPYKRITWLHTKNQKILEYNYNSTKTIFESEFKGRVYLEENNGALHISNVRKEDKGTYYMRVLRETENELKITLEV
Molecular weight 39.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp30-Val124
Aliases /Synonyms Signaling lymphocytic activation molecule 2, TCT.1, CD48 antigen, B-lymphocyte activation marker BLAST-1, BCM1, CD48, BLAST1, Leukocyte antigen MEM-102, SLAMF2, BCM1 surface antigen, SLAM family member 2
Reference ARO-P10555
Note For research use only.
Molecular Constructor
Asp30–Val124
Product name ARO-P10555-50
Uniprot ID P18181
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DINATTGSNVTLKIHKDPLGPYKRITWLHTKNQKILEYNYNSTKTIFESEFKGRVYLEENNGALHISNVRKEDKGTYYMRVLRETENELKITLEV
Molecular weight 39.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp30-Val124
Aliases /Synonyms Signaling lymphocytic activation molecule 2, TCT.1, CD48 antigen, B-lymphocyte activation marker BLAST-1, BCM1, CD48, BLAST1, Leukocyte antigen MEM-102, SLAMF2, BCM1 surface antigen, SLAM family member 2
Reference ARO-P10555
Note For research use only.
Molecular Constructor
Asp30–Val124

Recombinant Mouse CD48 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD48 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products