Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CER1 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
O55233
Molecular weight:
37.59 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Thr161–Glu246
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CER1 Protein, N-GST & C-His

Product name ARO-P10626-100
Uniprot ID O55233
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TCRTVPFNQTIAHEDCQKVVVQNNLCFGKCSSIRFPGEGADAHSFCSHCSPTKFTTVHLMLNCTSPTPVVKMVMQVEECQCMVKTE
Molecular weight 37.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr161-Glu246
Aliases /Synonyms DAN domain family member 4, CER1, DAND4, Cerberus-related protein, Cerberus
Reference ARO-P10626
Note For research use only.
Molecular Constructor
Thr161–Glu246
Product name ARO-P10626-1MG
Uniprot ID O55233
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TCRTVPFNQTIAHEDCQKVVVQNNLCFGKCSSIRFPGEGADAHSFCSHCSPTKFTTVHLMLNCTSPTPVVKMVMQVEECQCMVKTE
Molecular weight 37.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr161-Glu246
Aliases /Synonyms DAN domain family member 4, CER1, DAND4, Cerberus-related protein, Cerberus
Reference ARO-P10626
Note For research use only.
Molecular Constructor
Thr161–Glu246
Product name ARO-P10626-50
Uniprot ID O55233
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TCRTVPFNQTIAHEDCQKVVVQNNLCFGKCSSIRFPGEGADAHSFCSHCSPTKFTTVHLMLNCTSPTPVVKMVMQVEECQCMVKTE
Molecular weight 37.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr161-Glu246
Aliases /Synonyms DAN domain family member 4, CER1, DAND4, Cerberus-related protein, Cerberus
Reference ARO-P10626
Note For research use only.
Molecular Constructor
Thr161–Glu246

Introduction to Recombinant Mouse CER1 Protein

Recombinant Mouse CER1 Protein, also known as Cerberus-like protein 1, is a member of the Cerberus/DAN family of secreted proteins. It is encoded by the CER1 gene and is highly conserved across species, with 98% amino acid sequence identity between mouse and human CER1 proteins. This protein plays a crucial role in embryonic development and has been found to have potential therapeutic applications in various diseases.

Structure of Recombinant Mouse CER1 Protein

Recombinant Mouse CER1 Protein is a 267 amino acid protein with a predicted molecular weight of approximately 30 kDa. It contains a signal peptide at the N-terminus, which is responsible for its secretion into the extracellular space. The mature protein consists of a cysteine-rich domain, a DAN domain, and a C-terminal region with a conserved glycosylation site. The cysteine-rich domain is essential for the formation of disulfide bonds, which are crucial for the structural stability of the protein. The DAN domain is responsible for the inhibitory activity of CER1 protein, as discussed in the next section.

Activity of Recombinant Mouse CER1 Protein

Recombinant Mouse CER1 Protein is a secreted protein with potent inhibitory activity against members of the TGF-β superfamily, including BMPs (bone morphogenetic proteins), Activins, and Nodal. It binds to these ligands and blocks their interaction with their respective receptors, thereby inhibiting downstream signaling pathways. This activity is attributed to the DAN domain of CER1 protein, which has been shown to physically interact with the ligands and prevent their binding to their receptors. This inhibition of TGF-β signaling is crucial for proper embryonic development, as dysregulation of this pathway can lead to developmental defects.

In addition to its inhibitory activity, Recombinant Mouse CER1 Protein has also been found to have pro-angiogenic properties. It promotes the formation of new blood vessels by stimulating the proliferation and migration of endothelial cells. This activity is mediated by the cysteine-rich domain of CER1 protein, which has been shown to interact with the cell surface receptor neuropilin-1 and activate downstream signaling pathways. This pro-angiogenic activity of CER1 protein has potential therapeutic applications in diseases such as ischemic heart disease and peripheral arterial disease, where promoting angiogenesis can aid in tissue repair and regeneration.

Applications of Recombinant Mouse CER1 Protein

Recombinant Mouse CER1 Protein has a wide range of applications in both basic research and clinical settings. Its inhibitory activity against TGF-β signaling makes it a valuable tool for studying the role of this pathway in various biological processes. It has been used in studies investigating embryonic development, stem cell differentiation, and cancer progression. In addition, CER1 protein has been explored as a potential therapeutic agent for various diseases.

One of the most promising applications of Recombinant Mouse CER1 Protein is in the treatment of bone disorders such as osteoporosis and bone fractures. As BMPs are crucial for bone formation and remodeling, inhibiting their activity with CER1 protein can promote bone formation and prevent bone loss. Furthermore, CER1 protein has been shown to have anti-inflammatory properties, making it a potential therapeutic agent for inflammatory diseases such as rheumatoid arthritis and inflammatory bowel disease.

The pro-angiogenic activity of Recombinant Mouse CER1 Protein also has potential applications in the treatment of cardiovascular diseases. It can be used to promote the formation of new blood vessels in ischemic tissues, thereby improving blood flow and tissue repair. In addition, CER1 protein has been shown to have neuroprotective effects and can potentially be used in the treatment of neurodegenerative diseases.

Conclusion</h

Recombinant Mouse CER1 Protein, N-GST &amp; C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CER1 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products