Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse FGFR2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
B7ZWP2
Molecular weight:
35.98 kDa

Original price was: $322.00.Current price is: $274.00.

50ug 15% OFF + 274 loyalty points
Arg409–Asp702
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse FGFR2 Protein, N-His

Product name ARO-P10639-100
Uniprot ID B7ZWP2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence RDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLD
Molecular weight 35.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg409-Asp702
Aliases /Synonyms K-sam, KSAM, CD332, Keratinocyte growth factor receptor, Fibroblast growth factor receptor 2, FGFR-2, FGFR2, KGFR, BEK
Reference ARO-P10639
Note For research use only.
Molecular Constructor
Arg409–Asp702
Product name ARO-P10639-1MG
Uniprot ID B7ZWP2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence RDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLD
Molecular weight 35.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg409-Asp702
Aliases /Synonyms K-sam, KSAM, CD332, Keratinocyte growth factor receptor, Fibroblast growth factor receptor 2, FGFR-2, FGFR2, KGFR, BEK
Reference ARO-P10639
Note For research use only.
Molecular Constructor
Arg409–Asp702
Product name ARO-P10639-50
Uniprot ID B7ZWP2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence RDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLD
Molecular weight 35.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg409-Asp702
Aliases /Synonyms K-sam, KSAM, CD332, Keratinocyte growth factor receptor, Fibroblast growth factor receptor 2, FGFR-2, FGFR2, KGFR, BEK
Reference ARO-P10639
Note For research use only.
Molecular Constructor
Arg409–Asp702

Introduction

Recombinant Mouse FGFR2 Protein, also known as Fibroblast Growth Factor Receptor 2, is a crucial protein involved in cell signaling and regulation. It is a transmembrane receptor that plays a vital role in various biological processes such as cell proliferation, differentiation, and migration. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse FGFR2 Protein.

Structure of Recombinant Mouse FGFR2 Protein

Recombinant Mouse FGFR2 Protein is a type I transmembrane protein that belongs to the fibroblast growth factor receptor family. It is composed of three main domains: an extracellular ligand-binding domain, a transmembrane domain, and an intracellular tyrosine kinase domain. The extracellular domain contains three immunoglobulin-like domains (D1-D3) that are responsible for binding to fibroblast growth factors (FGFs). The transmembrane domain anchors the protein to the cell membrane, while the intracellular domain contains the tyrosine kinase activity responsible for signal transduction.

Activity of Recombinant Mouse FGFR2 Protein

Recombinant Mouse FGFR2 Protein is activated by binding to specific FGF ligands, which leads to dimerization and autophosphorylation of the intracellular domain. This results in the activation of downstream signaling pathways, including the mitogen-activated protein kinase (MAPK) and phosphoinositide 3-kinase (PI3K) pathways. These pathways play a crucial role in cell growth, differentiation, and survival.

The activity of Recombinant Mouse FGFR2 Protein is tightly regulated by various mechanisms, including ligand availability, receptor expression, and post-translational modifications. Dysregulation of FGFR2 signaling has been linked to various diseases, including cancer, skeletal disorders, and developmental abnormalities.

Applications of Recombinant Mouse FGFR2 Protein

Recombinant Mouse FGFR2 Protein has a wide range of applications in both research and therapeutic settings. Its role in cell signaling and regulation makes it a valuable tool for studying various cellular processes. Some of the notable applications of Recombinant Mouse FGFR2 Protein include:

1. Cancer Research

Aberrant FGFR2 signaling has been implicated in the development and progression of various cancers, including breast, lung, and gastric cancer. Recombinant Mouse FGFR2 Protein is used in cancer research to study the mechanisms underlying FGFR2-mediated tumorigenesis and to develop targeted therapies.

2. Skeletal Disorders

Mutations in the FGFR2 gene have been linked to skeletal disorders such as achondroplasia and craniosynostosis. Recombinant Mouse FGFR2 Protein is used to study the role of FGFR2 in skeletal development and to develop potential treatments for these disorders.

3. Wound Healing

FGF signaling has been shown to play a crucial role in wound healing and tissue repair. Recombinant Mouse FGFR2 Protein has been used in studies to investigate the effects of FGFs on wound healing and to develop potential therapies for promoting tissue regeneration.

4. Drug Development

The dysregulation of FGFR2 signaling has been implicated in various diseases, making it a potential target for drug development. Recombinant Mouse FGFR2 Protein is used in drug discovery and development to screen for potential inhibitors or activators of FGFR2 signaling.

5. Biotechnology

Recombinant Mouse FGFR2 Protein is also used in biotechnology for the production of therapeutic proteins. It is commonly expressed in various cell lines to produce large quantities of recombinant protein for use in research and therapeutic applications.

Conclusion

Recombinant Mouse FGFR2 Protein is a crucial protein involved in cell signaling and regulation. Its structure, activity, and applications make it a valuable tool for studying various cellular processes and developing potential

Recombinant Mouse FGFR2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse FGFR2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products