Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse IL21 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9ES17
Molecular weight:
16.54 kDa

Original price was: $322.00.Current price is: $274.00.

50ug 15% OFF + 274 loyalty points
Pro25–Ser146
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse IL21 Protein, N-His

Product name ARO-P12734-100
Uniprot ID Q9ES17
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Molecular weight 16.54 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro25-Ser146
Aliases /Synonyms Interleukin-21, IL-21, Il21
Reference ARO-P12734
Note For research use only.
Molecular Constructor
Pro25–Ser146
Product name ARO-P12734-1MG
Uniprot ID Q9ES17
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Molecular weight 16.54 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro25-Ser146
Aliases /Synonyms Interleukin-21, IL-21, Il21
Reference ARO-P12734
Note For research use only.
Molecular Constructor
Pro25–Ser146
Product name ARO-P12734-50
Uniprot ID Q9ES17
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Molecular weight 16.54 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro25-Ser146
Aliases /Synonyms Interleukin-21, IL-21, Il21
Reference ARO-P12734
Note For research use only.
Molecular Constructor
Pro25–Ser146

Introduction

Recombinant Mouse IL21 Protein, also known as Interleukin-21, is a cytokine that plays a crucial role in the immune response. It is a member of the Interleukin-2 (IL-2) cytokine family and is produced by activated T cells and natural killer (NK) cells. Recombinant Mouse IL21 Protein is a highly versatile protein with diverse functions and has been extensively studied for its potential therapeutic applications. In this article, we will explore the structure, activity, and applications of this important cytokine.

Structure of Recombinant Mouse IL21 Protein

Recombinant Mouse IL21 Protein is a 146 amino acid protein with a molecular weight of 15.9 kDa. It is composed of a four-helix bundle structure and has a high degree of sequence homology with other IL-2 family members. The protein contains a single disulfide bond that is essential for its biological activity. The crystal structure of Recombinant Mouse IL21 Protein has been determined, providing valuable insights into its function.

Activity of Recombinant Mouse IL21 Protein

Recombinant Mouse IL21 Protein exerts its activity by binding to the IL-21 receptor (IL-21R) on target cells. The IL-21R is a heterodimeric receptor composed of the IL-21Rα chain and the common γ-chain (γc). Upon binding, Recombinant Mouse IL21 Protein activates the Janus kinase-signal transducer and activator of transcription (JAK-STAT) signaling pathway, leading to the activation of various downstream signaling molecules.

One of the key functions of Recombinant Mouse IL21 Protein is its role in regulating the growth and differentiation of immune cells. It has been shown to promote the proliferation and survival of T cells, B cells, and NK cells, and also regulates the development and function of dendritic cells. Additionally, Recombinant Mouse IL21 Protein has been found to enhance the production of pro-inflammatory cytokines, such as interleukin-1 (IL-1), interleukin-6 (IL-6), and tumor necrosis factor-alpha (TNF-α), thereby contributing to the inflammatory response.

Applications of Recombinant Mouse IL21 Protein

Recombinant Mouse IL21 Protein has a wide range of potential therapeutic applications. One of the most promising areas of research is its use in cancer immunotherapy. Studies have shown that Recombinant Mouse IL21 Protein can enhance the anti-tumor activity of T cells and NK cells, making it a potential candidate for cancer treatment. It has also been investigated for its potential to enhance the efficacy of cancer vaccines.

In addition to cancer, Recombinant Mouse IL21 Protein has also been studied for its role in autoimmune diseases. It has been shown to suppress the production of autoantibodies and reduce the severity of symptoms in animal models of autoimmune diseases, such as rheumatoid arthritis and lupus.

Furthermore, Recombinant Mouse IL21 Protein has been investigated for its potential in treating viral infections. It has been found to have antiviral activity against a wide range of viruses, including HIV, hepatitis B and C, and influenza. Recombinant Mouse IL21 Protein has also been studied for its role in promoting tissue repair and regeneration, making it a potential candidate for tissue engineering and regenerative medicine.

Conclusion

In summary, Recombinant Mouse IL21 Protein is a highly versatile cytokine with diverse functions. Its structure, activity, and potential therapeutic applications make it a promising candidate for the treatment of various diseases, including cancer, autoimmune diseases, and viral infections. Further research and development of Recombinant Mouse IL21 Protein may lead to the development of novel therapies that can improve the lives of patients.

Recombinant Mouse IL21 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse IL21 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products