Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse Ins1/Insulin-1 Protein, C-Fc

Host species:
Insect cells
Origin species:
Mouse
Uniprot ID:
P01325
Molecular weight:
38.19 kDa

Original price was: $434.00.Current price is: $350.00.

50ug 19% OFF + 350 loyalty points
Met1–Asn108 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse Ins1/Insulin-1 Protein, C-Fc

Product name ARO-P16448-100
Uniprot ID P01325
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MALLVHFLPLLALLALWEPKPTQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Molecular weight 38.19 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Met1-Asn108
Aliases /Synonyms Insulin-1, Insulin-1 B chain, Insulin-1 A chain, Ins1, Ins-1
Reference ARO-P16448
Note For research use only.
Molecular Constructor
Met1–Asn108 Fc
Product name ARO-P16448-1MG
Uniprot ID P01325
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MALLVHFLPLLALLALWEPKPTQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Molecular weight 38.19 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Met1-Asn108
Aliases /Synonyms Insulin-1, Insulin-1 B chain, Insulin-1 A chain, Ins1, Ins-1
Reference ARO-P16448
Note For research use only.
Molecular Constructor
Met1–Asn108 Fc
Product name ARO-P16448-50
Uniprot ID P01325
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MALLVHFLPLLALLALWEPKPTQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Molecular weight 38.19 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Met1-Asn108
Aliases /Synonyms Insulin-1, Insulin-1 B chain, Insulin-1 A chain, Ins1, Ins-1
Reference ARO-P16448
Note For research use only.
Molecular Constructor
Met1–Asn108 Fc

There are no reviews yet.

Be the first to review “Recombinant Mouse Ins1/Insulin-1 Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products