Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mycoplasma pneumoniae P30 adhesin Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Uniprot ID:
P75330
Molecular weight:
21.07 kDa

Original price was: $301.00.Current price is: $271.00.

50ug 10% OFF + 271 loyalty points
His Lys101–Arg274
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mycoplasma pneumoniae P30 adhesin Protein, N-His

Product name ARO-P15845-100
Uniprot ID P75330
Origin species Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Expression system Prokaryotic expression
Raw Antigen Sequence KRKEKRLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR
Molecular weight 21.07 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys101-Arg274
Aliases /Synonyms P30 adhesin, 30 kDa adhesin-related protein, Cytadhesin P30, p30, MPN_453, MP388
Reference ARO-P15845
Note For research use only.
Molecular Constructor
His Lys101–Arg274
Product name ARO-P15845-1MG
Uniprot ID P75330
Origin species Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Expression system Prokaryotic expression
Raw Antigen Sequence KRKEKRLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR
Molecular weight 21.07 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys101-Arg274
Aliases /Synonyms P30 adhesin, 30 kDa adhesin-related protein, Cytadhesin P30, p30, MPN_453, MP388
Reference ARO-P15845
Note For research use only.
Molecular Constructor
His Lys101–Arg274
Product name ARO-P15845-50
Uniprot ID P75330
Origin species Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Expression system Prokaryotic expression
Raw Antigen Sequence KRKEKRLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR
Molecular weight 21.07 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys101-Arg274
Aliases /Synonyms P30 adhesin, 30 kDa adhesin-related protein, Cytadhesin P30, p30, MPN_453, MP388
Reference ARO-P15845
Note For research use only.
Molecular Constructor
His Lys101–Arg274

There are no reviews yet.

Be the first to review “Recombinant Mycoplasma pneumoniae P30 adhesin Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products