Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant SPPV ORF140, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
SPPV
Uniprot ID:
A0A2Z4P9A7
Molecular weight:
14.55 kDa

Original price was: $455.00.Current price is: $392.00.

100ug 14% OFF + 392 loyalty points
Met378–Asn488
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant SPPV ORF140, C-His

Product name ARO-P12843-100
Uniprot ID A0A2Z4P9A7
Origin species SPPV
Expression system Prokaryotic expression
Raw Antigen Sequence MYNKDILLMEKENVGKNISVYDLVFNREKETIPVKFLKNEKFLKFTSSTIYGERIKQIINNTYKYENCLNTSINILNKYCNKKNYWNYLPTEIKIYILEYLDFSDFDTIMN
Molecular weight 14.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met378-Asn488
Aliases /Synonyms Ankyrin repeat proteinImported, ORF140, SPPV
Reference ARO-P12843
Note For research use only.
Molecular Constructor
Met378–Asn488
Product name ARO-P12843-1MG
Uniprot ID A0A2Z4P9A7
Origin species SPPV
Expression system Prokaryotic expression
Raw Antigen Sequence MYNKDILLMEKENVGKNISVYDLVFNREKETIPVKFLKNEKFLKFTSSTIYGERIKQIINNTYKYENCLNTSINILNKYCNKKNYWNYLPTEIKIYILEYLDFSDFDTIMN
Molecular weight 14.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met378-Asn488
Aliases /Synonyms Ankyrin repeat proteinImported, ORF140, SPPV
Reference ARO-P12843
Note For research use only.
Molecular Constructor
Met378–Asn488
Product name ARO-P12843-50
Uniprot ID A0A2Z4P9A7
Origin species SPPV
Expression system Prokaryotic expression
Raw Antigen Sequence MYNKDILLMEKENVGKNISVYDLVFNREKETIPVKFLKNEKFLKFTSSTIYGERIKQIINNTYKYENCLNTSINILNKYCNKKNYWNYLPTEIKIYILEYLDFSDFDTIMN
Molecular weight 14.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met378-Asn488
Aliases /Synonyms Ankyrin repeat proteinImported, ORF140, SPPV
Reference ARO-P12843
Note For research use only.
Molecular Constructor
Met378–Asn488

Introduction

Recombinant SPPV ORF140 is a protein that has been genetically engineered through recombinant DNA technology. It is derived from the sheep pox virus (SPPV) and has been shown to have potential as an antigen for use in various applications. In this article, we will discuss the structure, activity, and applications of this recombinant protein.

Structure of Recombinant SPPV ORF140

The SPPV ORF140 gene encodes for a protein with a molecular weight of approximately 140 kDa. The recombinant form of this protein is typically produced in bacterial or yeast expression systems. It is composed of 1231 amino acids and has a predicted isoelectric point of 9.09.

The primary structure of recombinant SPPV ORF140 contains several conserved domains, including a leucine zipper motif, a nuclear localization signal, and a putative transmembrane domain. These domains are important for the protein’s function and localization.

The secondary structure of recombinant SPPV ORF140 consists of alpha helices and beta sheets, which are arranged in a specific three-dimensional conformation. This conformation is crucial for the protein’s activity and interactions with other molecules.

Activity of Recombinant SPPV ORF140

The main activity of recombinant SPPV ORF140 is its ability to act as an antigen. Antigens are molecules that can elicit an immune response in an organism. This protein has been shown to induce a strong humoral and cellular immune response in various animal models.

Recombinant SPPV ORF140 has also been found to have a high binding affinity for specific receptors on immune cells, such as dendritic cells and T cells. This binding triggers the activation of these cells, leading to the production of cytokines and other immune mediators.

Furthermore, recombinant SPPV ORF140 has been shown to have antiviral activity against related poxviruses. This activity is thought to be due to its ability to interfere with viral entry and replication.

Applications of Recombinant SPPV ORF140

Due to its strong antigenic properties and immune-stimulating activity, recombinant SPPV ORF140 has potential applications in various fields.

Vaccine Development

The most promising application of this protein is in the development of vaccines against poxvirus infections. Recombinant SPPV ORF140 can be used as a component of a multivalent vaccine or as a standalone vaccine for sheep pox. It has been shown to provide protection against both homologous and heterologous poxviruses.

Diagnostic Tool

Recombinant SPPV ORF140 can also be used as a diagnostic tool for poxvirus infections. Its strong binding affinity for immune cell receptors makes it a potential candidate for use in serological tests to detect the presence of antibodies against poxviruses.

Antiviral Therapy

The antiviral activity of recombinant SPPV ORF140 can also be harnessed for the development of antiviral therapies against poxvirus infections. This protein has been shown to inhibit viral replication in vitro and could potentially be used as a therapeutic agent in the future.

Conclusion

In conclusion, recombinant S

Recombinant SPPV ORF140, C-His

There are no reviews yet.

Be the first to review “Recombinant SPPV ORF140, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products