Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tadocizumab Biosimilar – Anti-ITGA2B_ITGB3 mAb – Research Grade

  • PX-TA1069-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
Fab-G1-kappa

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tadocizumab Biosimilar - Anti-ITGA2B_ITGB3 mAb - Research Grade

Product name Tadocizumab Biosimilar - Anti-ITGA2B_ITGB3 mAb - Research Grade
Uniprot ID P08514 & P05106
Source CAS 339086-80-5
Species Humanized
Raw Antigen Sequence MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE
Molecular weight 48kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tadocizumab,C4G1,YM-337,ITGA2B_ITGB3,anti-ITGA2B_ITGB3
Reference PX-TA1069
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-kappa
Clonality Monoclonal Antibody
Product name Tadocizumab Biosimilar - Anti-ITGA2B_ITGB3 mAb - Research Grade
Uniprot ID P08514 & P05106
Source CAS 339086-80-5
Species Humanized
Raw Antigen Sequence MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE
Molecular weight 48kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tadocizumab,C4G1,YM-337,ITGA2B_ITGB3,anti-ITGA2B_ITGB3
Reference PX-TA1069
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1069-50
Uniprot ID P08514 & P05106
Source CAS 339086-80-5
Species Humanized
Raw Antigen Sequence MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE
Molecular weight 48kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tadocizumab,C4G1,YM-337,ITGA2B_ITGB3,anti-ITGA2B_ITGB3
Reference PX-TA1069
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-kappa
Clonality Monoclonal Antibody

Introduction:

Tadocizumab Biosimilar, also known as Anti-ITGA2B_ITGB3 mAb, is a research-grade antibody that specifically targets the integrin αIIbβ3 receptor. This biosimilar is a promising therapeutic agent in the field of immunology and has potential applications in various diseases. In this article, we will discuss the structure, activity, and potential applications of Tadocizumab Biosimilar.

Structure:

Tadocizumab Biosimilar is a monoclonal antibody, which means it is a laboratory-produced protein that is designed to mimic the body’s natural antibodies. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL and CL’) and one variable domain (VL). The variable domains of the heavy and light chains come together to form the antigen-binding site, which is responsible for binding to the integrin αIIbβ3 receptor.

Activity:

Tadocizumab Biosimilar specifically targets the integrin αIIbβ3 receptor, which is found on the surface of platelets. This receptor plays a crucial role in platelet aggregation, which is the process of platelets clumping together to form blood clots. By binding to this receptor, Tadocizumab Biosimilar inhibits platelet aggregation and prevents the formation of blood clots. This activity makes it a potential therapeutic agent in diseases where excessive blood clotting is a major concern, such as heart attacks, strokes, and deep vein thrombosis.

Application in Thrombotic Diseases:

Thrombotic diseases, also known as thromboembolic diseases, are conditions where blood clots form in the blood vessels, obstructing blood flow and potentially causing serious complications. Tadocizumab Biosimilar has shown promising results in the treatment of these diseases. In a preclinical study, Tadocizumab Biosimilar was found to effectively inhibit platelet aggregation and prevent thrombus formation in a mouse model of arterial thrombosis. This study suggests that Tadocizumab Biosimilar could potentially be used as an anti-thrombotic agent in the treatment of thrombotic diseases.

Application in Cancer:

Integrin αIIbβ3 is also found on the surface of cancer cells and has been linked to cancer progression and metastasis. Tadocizumab Biosimilar has been shown to inhibit the growth and migration of cancer cells by targeting this integrin. In a study on ovarian cancer, Tadocizumab Biosimilar was found to significantly decrease tumor growth and metastasis in mice. This suggests that Tadocizumab Biosimilar could have potential applications in the treatment of cancer.

Application in Autoimmune Diseases:

Autoimmune diseases are conditions where the body’s immune system mistakenly attacks its own tissues. Tadocizumab Biosimilar has been shown to have immunomodulatory effects, which makes it a potential treatment option for autoimmune diseases. In a study on rheumatoid arthritis, Tadocizumab Biosimilar was found to decrease inflammation and joint damage in mice. This study suggests that Tadocizumab Biosimilar could potentially be used as a therapeutic agent in autoimmune diseases.

Conclusion:

Tadocizumab Biosimilar is a research-grade antibody that specifically targets the integrin αIIbβ3 receptor. Its activity in inhibiting platelet aggregation makes it a potential therapeutic agent in thrombotic diseases. Furthermore, its potential applications in cancer and autoimmune diseases make it a promising candidate for further research and development. With its unique structure and targeted activity, Tadocizumab Biosimilar has the potential to improve the treatment options for various diseases and improve patient outcomes.

SDS-PAGE for Tadocizumab Biosimilar - Anti-PAC-1 (ITGA2B and ITGB3) mAb - Research Grade

SDS-PAGE for Tadocizumab Biosimilar - Anti-PAC-1 (ITGA2B and ITGB3) mAb - Research Grade

Tadocizumab Biosimilar - Anti-PAC-1 (ITGA2B and ITGB3) mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tadocizumab Biosimilar - Anti-PAC-1 (ITGA2B and ITGB3) mAb - Research Grade in ELISA Assay

Tadocizumab Biosimilar - Anti-PAC-1 (ITGA2B and ITGB3) mAb - Research Grade in ELISA Assay

Tadocizumab Biosimilar - Anti-PAC-1 (ITGA2B and ITGB3) mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Tadocizumab Biosimilar - Anti-ITGA2B_ITGB3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tadocizumab Biosimilar – Anti-ITGA2B_ITGB3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products