Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rivabazumab Biosimilar – Anti-PcrV mAb – Research Grade

  • PX-TA1416-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
Fab'-G1-kappa

Original price was: $220.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Rivabazumab Biosimilar - Anti-PcrV mAb - Research Grade

Product name Rivabazumab Biosimilar - Anti-PcrV mAb - Research Grade
Uniprot ID O30527
Source CAS 1627519-84-9
Species Humanized
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Rivabazumab,BA1126,PcrV,anti-PcrV
Reference PX-TA1416
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-kappa
Clonality Monoclonal Antibody
Product name Rivabazumab Biosimilar - Anti-PcrV mAb - Research Grade
Uniprot ID O30527
Source CAS 1627519-84-9
Species Humanized
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Rivabazumab,BA1126,PcrV,anti-PcrV
Reference PX-TA1416
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1416-50
Uniprot ID O30527
Source CAS 1627519-84-9
Species Humanized
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Rivabazumab,BA1126,PcrV,anti-PcrV
Reference PX-TA1416
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-kappa
Clonality Monoclonal Antibody

General information on Anti-PcrV[Pseudomonas aeruginosa,Gram negative bacteria] (Rivabazumab) Monoclonal Antibody

Rivabazumab has been investigated for the treatment and prevention of Pseudomonas aeruginosa infections.

SEC-HPLC of Rivabazumab Biosimilar - Anti-PcrV mAb - Research Grade

SEC-HPLC of Rivabazumab Biosimilar - Anti-PcrV mAb - Research Grade

Rivabazumab Biosimilar - Anti-PcrV mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Rivabazumab Biosimilar - Anti-PcrV mAb - Research Grade

There are no reviews yet.

Be the first to review “Rivabazumab Biosimilar – Anti-PcrV mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products