Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Telimomab Biosimilar – Anti-CD5 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
Fab-nd-nd

Original price was: $213.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Telimomab Biosimilar - Anti-CD5 mAb - Research Grade

Product name Telimomab Biosimilar - Anti-CD5 mAb - Research Grade
Uniprot ID P06127
Species Mus musculus
Raw Antigen Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Telimomab,T101-ricin A chain immunotoxin,T101-RTA,CD5 ,anti-CD5
Reference PX-TA1229
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-nd-nd
Clonality Monoclonal Antibody
Product name Telimomab Biosimilar - Anti-CD5 mAb - Research Grade
Uniprot ID P06127
Species Mus musculus
Raw Antigen Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Telimomab,T101-ricin A chain immunotoxin,T101-RTA,CD5 ,anti-CD5
Reference PX-TA1229
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-nd-nd
Clonality Monoclonal Antibody
Product name PX-TA1229-50
Uniprot ID P06127
Species Mus musculus
Raw Antigen Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Telimomab,T101-ricin A chain immunotoxin,T101-RTA,CD5 ,anti-CD5
Reference PX-TA1229
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-nd-nd
Clonality Monoclonal Antibody

Introduction to Telimomab Biosimilar – Anti-CD5 mAb

Telimomab Biosimilar, also known as Anti-CD5 monoclonal antibody (mAb), is a research-grade therapeutic antibody that targets the CD5 protein. This protein is found on the surface of T cells and plays a crucial role in regulating immune responses. Telimomab Biosimilar is a biosimilar version of the original Telimomab, which was developed as a treatment for autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. In this article, we will explore the structure, activity, and potential applications of Telimomab Biosimilar.

Structure of Telimomab Biosimilar

Telimomab Biosimilar is a monoclonal antibody, meaning it is a type of protein made by the immune system that specifically binds to a target molecule. It is composed of two heavy chains and two light chains, each with a variable region that recognizes and binds to CD5. The constant region of the antibody is responsible for activating the immune system to eliminate the targeted cells.

The structure of Telimomab Biosimilar is similar to that of the original Telimomab, with minor differences due to the biosimilar manufacturing process. This ensures that Telimomab Biosimilar has the same binding affinity and activity as the original antibody.

Mechanism of Action of Telimomab Biosimilar

Telimomab Biosimilar works by binding to CD5 on the surface of T cells. This binding prevents the interaction between CD5 and its ligands, which are molecules that activate the T cells. As a result, the T cells are unable to mount an immune response, leading to the suppression of autoimmune reactions.

In addition to directly inhibiting T cell activation, Telimomab Biosimilar also triggers the immune system to eliminate the targeted T cells. This is achieved through a process called antibody-dependent cell-mediated cytotoxicity (ADCC), where immune cells such as natural killer cells are activated to kill the bound T cells.

Title: Applications of Telimomab Biosimilar

Telimomab Biosimilar has potential applications in the treatment of autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, and psoriasis. These diseases are characterized by an overactive immune response, and Telimomab Biosimilar can help regulate this response by targeting the CD5 protein.

In addition, Telimomab Biosimilar has shown promise in the treatment of certain types of cancer. CD5 is also found on the surface of certain cancer cells, and by targeting this protein, Telimomab Biosimilar can help in the destruction of these cancer cells. Clinical trials are currently underway to evaluate the effectiveness of Telimomab Biosimilar in treating various types of cancer.

Advantages of Telimomab Biosimilar

As a biosimilar, Telimomab Biosimilar offers several advantages over the original Telimomab. It is more cost-effective to produce, making it more accessible to patients. It also has a lower risk of immunogenicity, meaning it is less likely to cause an immune response in patients. Furthermore, Telimomab Biosimilar has the potential to be used in combination with other therapies, making it a versatile treatment option.

Conclusion

In summary, Telimomab Biosimilar is a research-grade therapeutic antibody that targets the CD5 protein. Its structure and mechanism of action are similar to the original Telimomab, but with the added benefits of being a biosimilar. Telimomab Biosimilar has potential applications in the treatment of autoimmune diseases and cancer, and its advantages make it a promising treatment option for patients. Further research and clinical trials are needed to fully understand the potential of this antibody in improving patient outcomes.

SDS-PAGE for Telimomab Biosimilar - Anti-CD5 mAb - Research Grade

SDS-PAGE for Telimomab Biosimilar - Anti-CD5 mAb - Research Grade

Telimomab Biosimilar - Anti-CD5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Telimomab Biosimilar - Anti-CD5  mAb - Research Grade

There are no reviews yet.

Be the first to review “Telimomab Biosimilar – Anti-CD5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products