Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Brazikumab Biosimilar – Anti-IL23A mAb – Research Grade

  • PX-TA1449-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2-lambda

Original price was: $232.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade

Product name Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1610353-18-8
Species Homo sapiens
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Brazikumab,AMG-139,MEDI2070,IL23A,anti-IL23A
Reference PX-TA1449
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1610353-18-8
Species Homo sapiens
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Brazikumab,AMG-139,MEDI2070,IL23A,anti-IL23A
Reference PX-TA1449
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name PX-TA1449-50
Uniprot ID Q9NPF7
Source CAS 1610353-18-8
Species Homo sapiens
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Brazikumab,AMG-139,MEDI2070,IL23A,anti-IL23A
Reference PX-TA1449
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody

Introduction

Brazikumab Biosimilar, also known as Anti-IL23A mAb, is a research grade monoclonal antibody that targets the interleukin-23A (IL-23A) protein. IL-23A is a cytokine that plays a key role in the development and maintenance of chronic inflammatory diseases, making it a promising therapeutic target for various conditions. In this article, we will explore the structure, activity, and potential applications of Brazikumab Biosimilar.

Structure of Brazikumab Biosimilar

Brazikumab Biosimilar is a recombinant humanized monoclonal antibody that is designed to mimic the structure and function of the naturally occurring antibody. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions of the antibody are responsible for binding to the IL-23A protein, while the constant regions provide stability and effector functions.

Activity of Brazikumab Biosimilar

Brazikumab Biosimilar works by specifically targeting and binding to the IL-23A protein, thereby inhibiting its activity. IL-23A is a pro-inflammatory cytokine that is produced by various immune cells, such as dendritic cells and macrophages. It plays a crucial role in the differentiation and activation of Th17 cells, which are a type of T-helper cell involved in the pathogenesis of many autoimmune and inflammatory diseases.

By binding to IL-23A, Brazikumab Biosimilar prevents its interaction with its receptor and blocks the downstream signaling pathways that lead to the production of pro-inflammatory cytokines. This results in a reduction of Th17 cell activity and a decrease in inflammation, making Brazikumab Biosimilar a promising therapeutic option for various chronic inflammatory diseases.

Potential Applications of Brazikumab Biosimilar

Brazikumab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various conditions, including psoriasis, psoriatic arthritis, Crohn’s disease, and ulcerative colitis. These are all chronic inflammatory diseases that are characterized by an overactive immune response and are associated with elevated levels of IL-23A.

The potential applications of Brazikumab Biosimilar extend beyond these conditions, as IL-23A has been implicated in the pathogenesis of other autoimmune and inflammatory diseases, such as rheumatoid arthritis, ankylosing spondylitis, and multiple sclerosis. Therefore, Brazikumab Biosimilar has the potential to be a versatile treatment option for a wide range of chronic inflammatory conditions.

Conclusion

Brazikumab Biosimilar, also known as Anti-IL23A mAb, is a research grade monoclonal antibody that specifically targets and inhibits the activity of the pro-inflammatory cytokine IL-23A. Its unique structure and mechanism of action make it a promising therapeutic option for various chronic inflammatory diseases. With ongoing clinical trials, Brazikumab Biosimilar has the potential to provide a much-needed treatment option for patients suffering from these conditions.

SEC-HPLC of Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade

SEC-HPLC of Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade

Brazikumab Biosimilar - Anti-IL23A mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade

SDS-PAGE for Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade

Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Brazikumab Biosimilar - Anti-IL23A mAb - Research Grade

There are no reviews yet.

Be the first to review “Brazikumab Biosimilar – Anti-IL23A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products