Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Setrusumab Biosimilar – Anti-SOST mAb – Research Grade

  • PX-TA1430-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2-lambda

Original price was: $212.00.Current price is: $167.00.

50ug 21% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

Product name Setrusumab Biosimilar - Anti-SOST mAb - Research Grade
Uniprot ID Q9BQB4
Source CAS 1847394-95-9
Species Homo sapiens
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Setrusumab,BPS-804,MOR-05813,SOST,anti-SOST
Reference PX-TA1430
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name Setrusumab Biosimilar - Anti-SOST mAb - Research Grade
Uniprot ID Q9BQB4
Source CAS 1847394-95-9
Species Homo sapiens
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Setrusumab,BPS-804,MOR-05813,SOST,anti-SOST
Reference PX-TA1430
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name PX-TA1430-50
Uniprot ID Q9BQB4
Source CAS 1847394-95-9
Species Homo sapiens
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Setrusumab,BPS-804,MOR-05813,SOST,anti-SOST
Reference PX-TA1430
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody

General information on Anti-SOST[Homo sapiens] (Setrusumab) Monoclonal Antibody

Setrusumab is investigated to treat Post Menopausal Women with low Bone Mineral Density.

SDS-PAGE for Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

SDS-PAGE for Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

Setrusumab Biosimilar - Anti-SOST mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

SEC-HPLC of Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

Setrusumab Biosimilar - Anti-SOST mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Setrusumab Biosimilar - Anti-SOST mAb - Research Grade

There are no reviews yet.

Be the first to review “Setrusumab Biosimilar – Anti-SOST mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products