Brand: ProteoGenix

Tildrakizumab Biosimilar – Anti-IL23A mAb – Research Grade

PX-TA1309-50
Validated ELISA

Clonality:: Monoclonal Antibody
Isotype:: IgG1, kappa

Original price was: $215.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points

Size Size

50ug Original price was: $215.00.Current price is: $167.00.
100ug Original price was: $333.00.Current price is: $238.00.
1MG Original price was: $627.00.Current price is: $482.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

SEC-HPLC of Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade

Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade

Product name	Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID	Q9NPF7
Source	CAS 1326244-10-3
Species	Humanized
Raw Antigen Sequence	MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Molecular weight	144kDa
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Tildrakizumab,MK-3222, SCH900222,IL23A,anti-IL23A
Reference	PX-TA1309
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-kappa
Clonality	Monoclonal Antibody

Product name	Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID	Q9NPF7
Source	CAS 1326244-10-3
Species	Humanized
Raw Antigen Sequence	MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Molecular weight	144kDa
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Tildrakizumab,MK-3222, SCH900222,IL23A,anti-IL23A
Reference	PX-TA1309
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-kappa
Clonality	Monoclonal Antibody

Product name	PX-TA1309-50
Uniprot ID	Q9NPF7
Source	CAS 1326244-10-3
Species	Humanized
Raw Antigen Sequence	MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Molecular weight	144kDa
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Aliases /Synonyms	Tildrakizumab,MK-3222, SCH900222,IL23A,anti-IL23A
Reference	PX-TA1309
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody

General information on Anti-IL23A[Homo sapiens] (Tildrakizumab) Monoclonal Antibody

Tildrakizumab is a humanized IgG1 kappa antibody that targets interleukin 23 p19 with high affinity. It is investigated for the treatment of chronic plaque psoriasis.

SEC-HPLC of Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade

Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade

Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Tildrakizumab Biosimilar – Anti-IL23A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Tildrakizumab Biosimilar – Anti-IL23A mAb – Research Grade

Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade

General information on Anti-IL23A[Homo sapiens] (Tildrakizumab) Monoclonal Antibody

SEC-HPLC of Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade

SDS-PAGE for Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade

Related products

Human IL23A recombinant protein

Human IgG1 LALA Isotype Control antibody (HyHEL-10)

Guselkumab ELISA Kit

InVivoMAb Anti-Human IL23A (Iv0034)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Tildrakizumab Biosimilar – Anti-IL23A mAb – Research Grade

Specifications Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade

Description

General information on Anti-IL23A[Homo sapiens] (Tildrakizumab) Monoclonal Antibody

Documents

QC & Validation

SEC-HPLC of Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade

SDS-PAGE for Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade

3D Representation

Reviews

Related products

Human IL23A recombinant protein

Human IgG1 LALA Isotype Control antibody (HyHEL-10)

Guselkumab ELISA Kit

InVivoMAb Anti-Human IL23A (Iv0034)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Tildrakizumab Biosimilar - Anti-IL23A mAb - Research Grade