Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

TNFSF15/TL1A Monoclonal Antibody

  • PTX20632-100
  • Validated ELISA

Original price was: $521.00.Current price is: $407.00.

100ug 22% OFF + 407 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
TNFSF15/TL1A Monoclonal Antibody binds to Human TNFSF15/TL1A recombinant protein in ELISA Assay
SDS-PAGE for TNFSF15/TL1A Monoclonal Antibody
TNFSF15/TL1A Monoclonal Antibody

TNFSF15/TL1A Monoclonal Antibody

Product name PTX20632-100
Uniprot ID O95150
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Delivery condition Blue ice (+4°)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C or -80°C for long term
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-TNFSF15, Vascular endothelial cell growth inhibitor, VEGI, Tumor necrosis factor ligand superfamily member 15, TL1, TNF ligand-related molecule 1
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant
Clone Name SAA2022
Protein Name TNFSF15/TL1A
Product name PTX20632-1MG
Uniprot ID O95150
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Delivery condition Blue ice (+4°)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C or -80°C for long term
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-TNFSF15, Vascular endothelial cell growth inhibitor, VEGI, Tumor necrosis factor ligand superfamily member 15, TL1, TNF ligand-related molecule 1
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant
Clone Name SAA2022
Protein Name TNFSF15/TL1A
Product name PTX20632-50
Uniprot ID O95150
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Delivery condition Blue ice (+4°)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C or -80°C for long term
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-TNFSF15, Vascular endothelial cell growth inhibitor, VEGI, Tumor necrosis factor ligand superfamily member 15, TL1, TNF ligand-related molecule 1
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant
Clone Name SAA2022
Protein Name TNFSF15/TL1A

TNFSF15/TL1A Monoclonal Antibody binds to Human TNFSF15/TL1A recombinant protein in ELISA Assay

TNFSF15/TL1A Monoclonal Antibody binds to Human TNFSF15/TL1A recombinant protein in ELISA Assay

Human TNFSF15/TL1A recombinant protein(cat. No.PX-P6413) at 0.5µg/mL (100µL/well) can bind TNFSF15/TL1A Monoclonal Antibody in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for TNFSF15/TL1A Monoclonal Antibody

SDS-PAGE for TNFSF15/TL1A Monoclonal Antibody

TNFSF15/TL1A Monoclonal Antibody, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

TNFSF15/TL1A Monoclonal Antibody

There are no reviews yet.

Be the first to review “TNFSF15/TL1A Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products