Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TNFSF15/TL1A recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O95150
Molecular weight:
23.37 kDa

$451.00

100ug + 451 loyalty points
Ala71–Leu251 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human TNFSF15/TL1A recombinant protein

Human TNFSF15/TL1A recombinant protein

Product name Human TNFSF15/TL1A recombinant protein
Uniprot ID O95150
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence ALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Molecular weight 23.37 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala71-Leu251
Aliases /Synonyms TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, Tumor necrosis factor ligand superfamily member 15, membrane form, Tumor necrosis factor ligand superfamily member 15, secreted form, TNFSF15, TL1, VEGITumor necrosis factor ligand superfamily member 15
Reference PX-P6413
Note For research use only.
Molecular Constructor
Ala71–Leu251 His

Introduction:

Tumor necrosis factor ligand superfamily member 15 (TNFSF15), also known as TNF ligand-related molecule 1 (TL1) or vascular endothelial cell growth inhibitor (VEGI), is a protein that belongs to the TNF superfamily. It is a potent cytokine that plays a crucial role in regulating immune responses and inflammation. In this article, we will discuss the structure, activity, and potential applications of human TNFSF15/TL1A recombinant protein as a drug target.

Structure of TNFSF15/TL1A:

The human TNFSF15/TL1A protein is a type II transmembrane protein that consists of 251 amino acids with a molecular weight of approximately 28 kDa. It is composed of an extracellular domain, a transmembrane domain, and a cytoplasmic domain. The extracellular domain contains a TNF homology domain, which is responsible for binding to its receptor, death receptor 3 (DR3). The transmembrane domain anchors the protein to the cell membrane, and the cytoplasmic domain is involved in intracellular signaling.

Activity of TNFSF15/TL1A:

TNFSF15/TL1A is primarily produced by activated T cells, natural killer cells, and dendritic cells. It acts as a pro-inflammatory cytokine and plays a crucial role in regulating immune responses. It binds to its receptor DR3, which is expressed on various immune cells, and activates downstream signaling pathways, including NF-κB and MAPK, leading to the production of other pro-inflammatory cytokines. TNFSF15/TL1A also promotes the survival and proliferation of T cells and enhances the cytotoxic activity of natural killer cells.

Role as a Drug Target:

Due to its potent pro-inflammatory activity, TNFSF15/TL1A has been identified as a potential drug target for various inflammatory diseases, including inflammatory bowel disease, rheumatoid arthritis, and psoriasis. Inhibition of TNFSF15/TL1A signaling has been shown to reduce inflammation and ameliorate disease symptoms in preclinical studies.

Potential Applications of Human TNFSF15/TL1A Recombinant Protein:

Recombinant TNFSF15/TL1A protein has been extensively studied as a potential therapeutic agent for the treatment of various inflammatory diseases. It can be produced in large quantities using recombinant DNA technology and is available in both membrane-bound and secreted forms.

Membrane Form:

The membrane-bound form of TNFSF15/TL1A can be used as a potential drug target for the development of small molecule inhibitors or monoclonal antibodies that can block its interaction with DR3. This can effectively inhibit downstream signaling pathways and reduce inflammation in diseases such as inflammatory bowel disease and rheumatoid arthritis.

Secreted Form:

The secreted form of TNFSF15/TL1A can be used as a therapeutic protein for the treatment of inflammatory diseases. It has been shown to have anti-inflammatory properties and can inhibit the production of other pro-inflammatory cytokines. Recombinant TNFSF15/TL1A protein has been successfully used in preclinical studies to reduce inflammation and improve disease symptoms in animal models of inflammatory bowel disease and psoriasis.

Conclusion:

In conclusion, human TNFSF15/TL1A recombinant protein is a promising drug target for the treatment of various inflammatory diseases. Its structure, activity, and potential applications as a therapeutic protein have been extensively studied, and it holds great potential for the development of novel anti-inflammatory therapies. Further research and clinical trials are needed to fully understand the role of TNFSF15/TL1A in disease pathogenesis and to develop effective treatments using this protein.

Human TNFSF15/TL1A recombinant protein

There are no reviews yet.

Be the first to review “Human TNFSF15/TL1A recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products