Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade

  • PX-TA2091-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $232.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade

Product name Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade
Uniprot ID P18627
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-FDC, LAG3, Lymphocyte activation gene 3 protein, CD223, sLAG-3, LAG-3
Reference PX-TA2091
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade
Uniprot ID P18627
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-FDC, LAG3, Lymphocyte activation gene 3 protein, CD223, sLAG-3, LAG-3
Reference PX-TA2091
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA2091-50
Uniprot ID P18627
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FDC, LAG3, Lymphocyte activation gene 3 protein, CD223, sLAG-3, LAG-3
Reference PX-TA2091
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade

Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade is a highly specialized antibody that has been developed for its unique ability to target and bind to follicular dendritic cells (FDCs). FDCs are a type of immune cell found in the lymph nodes, spleen, and other lymphoid tissues, and are crucial for the development and maintenance of the body’s immune response. This biosimilar antibody is a powerful tool for research in the field of immunology and has the potential to revolutionize the treatment of immune-related diseases.

Structure of Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade

Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade is a monoclonal antibody, meaning it is produced by a single type of immune cell. It is a recombinant antibody, engineered to mimic the structure and function of a naturally occurring antibody. This biosimilar antibody is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy and light chains each contain a variable region and a constant region. The variable region is responsible for binding to its specific target, FDCs in this case, while the constant region determines the antibody’s effector functions.

Activity of Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade

The main activity of Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade is its ability to target and bind to FDCs. FDCs play a critical role in the immune response by capturing and presenting antigens to immune cells, such as B cells. By binding to FDCs, this biosimilar antibody can disrupt the antigen presentation process, leading to a decrease in the activation and proliferation of B cells. This activity has potential therapeutic applications in diseases where B cell activation is dysregulated, such as autoimmune disorders and certain types of cancer.

Title: Applications of Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade has a wide range of potential applications in both research and therapeutic settings. In research, this biosimilar antibody can be used as a tool to study the role of FDCs in the immune response. It can also be used in experiments to block or disrupt the function of FDCs and observe the effects on the immune system. In a therapeutic setting, this biosimilar antibody has the potential to treat diseases where FDCs play a critical role, such as rheumatoid arthritis, multiple sclerosis, and certain types of lymphoma.

Advantages of Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade

Compared to other antibodies targeting FDCs, Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade has several advantages. Firstly, it is a biosimilar antibody, meaning it is produced through a highly controlled and reproducible process, ensuring consistent quality and activity. Secondly, it has a high specificity for FDCs, minimizing off-target effects. Finally, this biosimilar antibody has a long half-life, allowing for less frequent dosing and potentially improving patient compliance.

Conclusion

In summary, Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade is a highly specialized antibody with a unique ability to target and bind to FDCs. Its structure, activity, and potential applications make it a valuable tool for research in immunology and a promising therapeutic agent for diseases where FDCs play a critical role. With its advantages over other FDC-targeting antibodies, Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade has the potential to make a significant impact in the field of immune-related diseases.

Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade in ELISA Assay

Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade in ELISA Assay

Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade

SDS-PAGE for Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade

Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade , on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade

There are no reviews yet.

Be the first to review “Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products