Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Xaa-Pro aminopeptidase 2(XPNPEP2)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
O43895
Molecular weight:
72.1kDa

$217.00

50ug + 217 loyalty points
Gly21–Ala650 His
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Xaa-Pro aminopeptidase 2(XPNPEP2)

Xaa-Pro aminopeptidase 2(XPNPEP2)

Product name Xaa-Pro aminopeptidase 2(XPNPEP2)
Uniprot ID O43895
Uniprot link https://www.uniprot.org/uniprot/O43895
Expression system Prokaryotic expression
Sequence MGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAALEHHHHHH
Molecular weight 72.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >15% by SDS-PAGE
Buffer PBS，pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly21-Ala650
Protein Accession O43895
Spec:Entrez GeneID 7512
Spec:NCBI Gene Aliases APP2; AEACEI
Spec:SwissProtID O75994
NCBI Reference O43895
Aliases /Synonyms Aminoacylproline aminopeptidase,Membrane-bound aminopeptidase P,Membrane-bound APP,Membrane-bound AmP,mAmP,X-Pro aminopeptidase 2
Reference PX-P4837
Note For research use only
Molecular Constructor
Gly21–Ala650 His
Product name Xaa-Pro aminopeptidase 2(XPNPEP2)
Uniprot ID O43895
Uniprot link https://www.uniprot.org/uniprot/O43895
Expression system Prokaryotic expression
Sequence MGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAALEHHHHHH
Molecular weight 72.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >15% by SDS-PAGE
Buffer PBS，pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly21-Ala650
Protein Accession O43895
Spec:Entrez GeneID 7512
Spec:NCBI Gene Aliases APP2; AEACEI
Spec:SwissProtID O75994
NCBI Reference O43895
Aliases /Synonyms Aminoacylproline aminopeptidase,Membrane-bound aminopeptidase P,Membrane-bound APP,Membrane-bound AmP,mAmP,X-Pro aminopeptidase 2
Reference PX-P4837
Note For research use only
Molecular Constructor
Gly21–Ala650 His

There are no reviews yet.

Be the first to review “Xaa-Pro aminopeptidase 2(XPNPEP2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products