Contact Book a call
+1 786 648 6837
Contact Book a call
Contact Book a call
XtenCHO ™ Starter kit XtenCHO ™ Starter kit Nycodenz AG® Nycodenz AG®
View all Products

Human CD36 (AA 104-294) Recombinant Protein

Reference:
Size

100ug, 50ug
Brand

Product type

Host Species

Applications

,

Tags:
Specification
Documents
Publications
Reviews
Product nameHuman CD36 (AA 104-294) Recombinant Protein
Uniprot IDP16671
Uniprot linkhttp://www.uniprot.org/uniprot/P16671
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMAHNHRHKHKLTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQV RTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAA SFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRF
Molecular weight22,73 kDa
Protein delivered with Tag?Yes
Purity estimated80%
BufferPBS, imidazole 300mM, Urea 8M, pH7.4
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypePartial
Protein AccessionAAA16068.1
Spec:Entrez GeneID948
Spec:NCBI Gene AliasesCHDS7, GPIV, PASIV, FAT, SCARB3, GP3B, BDPLT10, GP4
Spec:SwissProtIDP16671
NCBI ReferenceAAA16068.1
Aliases /SynonymsCD36 (AA 104-294), antigen CD36, Platelet glycoprotein 4, Fatty acid translocase, FAT, Glycoprotein IIIb, GPIIIB, Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV, GPIV, Thrombospondin receptor, CD_antigen: CD36, GP3B, GP4
ReferencePX-P1061
NoteFor research use only
Datasheet Download
MSDS Download

Publication

  • 1: Šerý O, Janoutová J, Ewerlingová L, Hálová A, Lochman J, Janout V, Khan NA, Balcar VJ. CD36 gene polymorphism is associated with Alzheimer's disease. Biochimie. 2017 Apr;135:46-53. doi: 10.1016/j.biochi.2017.01.009. Epub 2017 Jan 20. PubMed PMID: 28111291.
  • 2: Sini S, Deepa D, Harikrishnan S, Jayakumari N. High-density lipoprotein from subjects with coronary artery disease promotes macrophage foam cell formation: role of scavenger receptor CD36 and ERK/MAPK signaling. Mol Cell Biochem. 2017 Mar;427(1-2):23-34. doi: 10.1007/s11010-016-2895-7. Epub 2016 Dec 19. PubMed PMID: 27995417.
  • 3: Pascual G, Avgustinova A, Mejetta S, Martín M, Castellanos A, Attolini CS, Berenguer A, Prats N, Toll A, Hueto JA, Bescós C, Di Croce L, Benitah SA. Targeting metastasis-initiating cells through the fatty acid receptor CD36. Nature. 2017 Jan 5;541(7635):41-45. doi: 10.1038/nature20791. Epub 2016 Dec 7. PubMed PMID: 27974793.
  • 4: Kalai M, Dridi M, Chaouch L, Moumni I, Ouragini H, Darragi I, Boudrigua I, Chaouachi D, Mellouli F, Bejaoui M, Abbes S. The role of rs1984112_G at CD36 gene in increasing reticulocyte level among sickle cell disease patients. Hematology. 2017 Apr;22(3):178-182. doi: 10.1080/10245332.2016.1253253. Epub 2016 Nov 20. PubMed PMID: 27869039.
  • 5: Jayewardene AF, Mavros Y, Gwinn T, Hancock DP, Rooney KB. Associations between CD36 gene polymorphisms and metabolic response to a short-term endurance-training program in a young-adult population. Appl Physiol Nutr Metab. 2016 Feb;41(2):157-67. doi: 10.1139/apnm-2015-0430. Epub 2015 Oct 22. PubMed PMID: 26830498.
  • 6: Daoudi H, Plesník J, Sayed A, Šerý O, Rouabah A, Rouabah L, Khan NA. Oral Fat Sensing and CD36 Gene Polymorphism in Algerian Lean and Obese Teenagers. Nutrients. 2015 Nov 4;7(11):9096-104. doi: 10.3390/nu7115455. PubMed PMID: 26556365; PubMed Central PMCID: PMC4663583.
  • 7: Lo SC, Lin KH, Hsieh HH, Lin DT, Hu CY. Genetic variations of CD36 and low platelet CD36 expression - a risk factor for lipemic plasma donation in Taiwanese apheresis donors. Vox Sang. 2016 Apr;110(3):236-43. doi: 10.1111/vox.12356. Epub 2015 Nov 3. PubMed PMID: 26528880.
  • 8: Hou Y, Wu M, Wei J, Ren Y, Du C, Wu H, Li Y, Shi Y. CD36 is involved in high glucose-induced epithelial to mesenchymal transition in renal tubular epithelial cells. Biochem Biophys Res Commun. 2015 Dec 4-11;468(1-2):281-6. doi: 10.1016/j.bbrc.2015.10.112. Epub 2015 Oct 24. PubMed PMID: 26505798.
  • 9: Nath A, Li I, Roberts LR, Chan C. Elevated free fatty acid uptake via CD36 promotes epithelial-mesenchymal transition in hepatocellular carcinoma. Sci Rep. 2015 Oct 1;5:14752. doi: 10.1038/srep14752. PubMed PMID: 26424075; PubMed Central PMCID: PMC4589791.
  • 10: Sundaresan S, Abumrad NA. Dietary Lipids Inform the Gut and Brain about Meal Arrival via CD36-Mediated Signal Transduction. J Nutr. 2015 Oct;145(10):2195-200. doi: 10.3945/jn.115.215483. Epub 2015 Aug 12. Review. PubMed PMID: 26269236; PubMed Central PMCID: PMC4580959.
  • 11: Schörghofer D, Kinslechner K, Preitschopf A, Schütz B, Röhrl C, Hengstschläger M, Stangl H, Mikula M. The HDL receptor SR-BI is associated with human prostate cancer progression and plays a possible role in establishing androgen independence. Reprod Biol Endocrinol. 2015 Aug 7;13:88. doi: 10.1186/s12958-015-0087-z. PubMed PMID: 26251134; PubMed Central PMCID: PMC4528807.
  • 12: Allum F, Shao X, Guénard F, Simon MM, Busche S, Caron M, Lambourne J, Lessard J, Tandre K, Hedman ÅK, Kwan T, Ge B; Multiple Tissue Human Expression Resource Consortium., Rönnblom L, McCarthy MI, Deloukas P, Richmond T, Burgess D, Spector TD, Tchernof A, Marceau S, Lathrop M, Vohl MC, Pastinen T, Grundberg E. Characterization of functional methylomes by next-generation capture sequencing identifies novel disease-associated variants. Nat Commun. 2015 May 29;6:7211. doi: 10.1038/ncomms8211. Erratum in: Nat Commun. 2015;6:8016. PubMed PMID: 26021296; PubMed Central PMCID: PMC4544751.
  • 13: Krzystolik A, Dziedziejko V, Safranow K, Kurzawski G, Rać M, Sagasz-Tysiewicz D, Poncyljusz W, Jakubowska K, Chlubek D, Rać ME. Is plasma soluble CD36 associated with cardiovascular risk factors in early onset coronary artery disease patients? Scand J Clin Lab Invest. 2015 Sep;75(5):398-406. doi: 10.3109/00365513.2015.1031693. Epub 2015 Apr 28. PubMed PMID: 25916834.
  • 14: Mrizak I, Šerý O, Plesnik J, Arfa A, Fekih M, Bouslema A, Zaouali M, Tabka Z, Khan NA. The A allele of cluster of differentiation 36 (CD36) SNP 1761667 associates with decreased lipid taste perception in obese Tunisian women. Br J Nutr. 2015 Apr 28;113(8):1330-7. doi: 10.1017/S0007114515000343. Epub 2015 Mar 30. PubMed PMID: 25822988.
  • 15: Melis M, Sollai G, Muroni P, Crnjar R, Barbarossa IT. Associations between orosensory perception of oleic acid, the common single nucleotide polymorphisms (rs1761667 and rs1527483) in the CD36 gene, and 6-n-propylthiouracil (PROP) tasting. Nutrients. 2015 Mar 20;7(3):2068-84. doi: 10.3390/nu7032068. PubMed PMID: 25803547; PubMed Central PMCID: PMC4377901.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human CD36 (AA 104-294) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Cobolimab Biosimilar – Anti-HAVCR2, TIM3, CD366 mAb – Research Grade
Biosimilar

Cobolimab Biosimilar – Anti-HAVCR2, TIM3, CD366 mAb – Research Grade

PX-TA1544 476$
View product

Contact us

Send us a message from the form below







    Cart (0 Items)

    Your cart is currently empty.

    View Products