Product name	IGFBP1 protein - Human IGFBP1 full length Recombinant Protein
Uniprot ID	P08833
Uniprot link	http://www.uniprot.org/uniprot/P08833
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYF
Molecular weight	28.74kDa
Protein delivered with Tag?	Yes
Purity estimated	95%
Buffer	PBS, pH 7.5 with 0.2mM β-Met and glycerol 2.5%
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Full-length
Protein Accession	ACO37638.1
Spec:Entrez GeneID	3484
Spec:NCBI Gene Aliases	hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID	P08833
NCBI Reference	ACO37638.1
Aliases /Synonyms	IGFBP1 full length, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference	PX-P2077
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “IGFBP1 protein – Human IGFBP1 full length Recombinant Protein”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

IGFBP1 protein – Human IGFBP1 full length Recombinant Protein