Tomato Sl_eIF4E2 Recombinant Protein

Reference:
Size

100ug, 50ug

Brand

Product type

Host Species

Applications

,

Product nameTomato Sl_eIF4E2 Recombinant Protein
Origin speciesTomato
Expression systemProkaryotic expression
SequenceMGSSHHHHHHSSGLVPRGSHMMADELNKAALEEYKSSSVEDRGEEGEIVGESDDTASSLGKQITMKHPLEHSWTFWFDNP SGKSKQAAWGSSIRPIYTFSTAEDFWSVYNNIHHPSKLAVGADFHCFKNKIEPKWEDPVCANGGKWTMNFSRGKSDTCWL YTLLALIGEQFDYGDEICGAVINVRVRQEKIALWTRNAANETAQDV
Molecular weight23,10 kDa
Purity estimated≥50%
BufferPBS, Urea 8M
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypePartial
Protein AccessionXP_004231545.1
NCBI ReferenceXP_004231545.1
Aliases /SynonymsSl_eIF4E2, eukaryotic translation initiation factor 4E-1-like
ReferencePX-P1151
NoteFor research use only

Description of Tomato Sl_eIF4E2 Recombinant Protein

General information on Tomato Sl_eIF4E2 Recombinant Protein

Belongs to a small multigenic family and three genes, eIF4E1, eIF4E2 and eIF(iso)4E, have been identified in tomato. It has been demonstrated that eIF4E-mediated natural recessive resistances against potyviruses result from non-synonymous mutations in an eIF4E protein, which impair its direct interaction with the potyviral protein VPg. In tomato, the role of eIF4E proteins in potyvirus resistance is still unclear because natural or induced mutations in eIF4E1 confer only a narrow resistance spectrum against potyviruses. This contrasts with the broad spectrum resistance identified in the natural diversity of tomato.

Publication

  • 1: Gauffier C, Lebaron C, Moretti A, Constant C, Moquet F, Bonnet G, Caranta C, Gallois JL. A TILLING approach to generate broad-spectrum resistance to potyviruses in tomato is hampered by eIF4E gene redundancy. Plant J. 2016 Mar;85(6):717-29. doi: 10.1111/tpj.13136. PubMed PMID: 26850324.
  • 2: Mazier M, Flamain F, Nicolaï M, Sarnette V, Caranta C. Knock-down of both eIF4E1 and eIF4E2 genes confers broad-spectrum resistance against potyviruses in tomato. PLoS One. 2011;6(12):e29595. doi: 10.1371/journal.pone.0029595. Epub 2011 Dec 29. PubMed PMID: 22242134; PubMed Central PMCID: PMC3248445.
  • 3: Aoki K, Yano K, Suzuki A, Kawamura S, Sakurai N, Suda K, Kurabayashi A, Suzuki T, Tsugane T, Watanabe M, Ooga K, Torii M, Narita T, Shin-I T, Kohara Y, Yamamoto N, Takahashi H, Watanabe Y, Egusa M, Kodama M, Ichinose Y, Kikuchi M, Fukushima S, Okabe A, Arie T, Sato Y, Yazawa K, Satoh S, Omura T, Ezura H, Shibata D. Large-scale analysis of full-length cDNAs from the tomato (Solanum lycopersicum) cultivar Micro-Tom, a reference system for the Solanaceae genomics. BMC Genomics. 2010 Mar 30;11:210. doi: 10.1186/1471-2164-11-210. PubMed PMID: 20350329; PubMed Central PMCID: PMC2859864.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Tomato Sl_eIF4E2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below







    Cart (1 Item)