Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD275/ICOSLG Antibody (SAA0089), APC

  • ARO-A10460-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Human
Isotype:
IgG2, kappa
Target species:
Human
Clone Name:
SAA0089

Original price was: $522.00.Current price is: $421.00.

50ug 19% OFF + 421 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD275/ICOSLG Antibody (SAA0089), APC

Product name ARO-A10460-100
Uniprot ID O75144
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Reference ARO-A10460
Note For research use only.
Isotype IgG2, kappa
Clonality Monoclonal Antibody
Target B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Clone Name SAA0089
Target species Human
Product name ARO-A10460-1MG
Uniprot ID O75144
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Reference ARO-A10460
Note For research use only.
Isotype IgG2, kappa
Clonality Monoclonal Antibody
Target B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Clone Name SAA0089
Target species Human
Product name ARO-A10460-50
Uniprot ID O75144
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Reference ARO-A10460
Note For research use only.
Isotype IgG2, kappa
Clonality Monoclonal Antibody
Target B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Clone Name SAA0089
Target species Human

Flow Cytometry results for Anti-Human CD275/ICOSLG Antibody (SAA0089), APC

Flow Cytometry results for Anti-Human CD275/ICOSLG Antibody (SAA0089), APC

Target Cells were stained with an irrelevant antibody or Anti-Human CD275/ICOSLG Antibody (SAA0089), APC at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human CD275/ICOSLG Antibody (SAA0089), APC”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products