Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human EPO Antibody (SAA0420)

Original price was: $370.00.Current price is: $284.00.

50ug 23% OFF + 284 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human EPO Antibody (SAA0420)

Product name ARO-A15539-100
Uniprot ID P01588
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15539
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen EPO
Clone Name SAA0420
Protein Name EPO
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15539-1MG
Uniprot ID P01588
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15539
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen EPO
Clone Name SAA0420
Protein Name EPO
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15539-50
Uniprot ID P01588
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15539
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen EPO
Clone Name SAA0420
Protein Name EPO
Target species Anti-Human Monoclonal Antibody

Introduction

Anti-Human EPO Antibody (SAA0420) is a highly specific monoclonal antibody that targets the human erythropoietin (EPO) protein. EPO is a cytokine hormone that plays a crucial role in regulating red blood cell production. This antibody has been extensively studied and has shown promising results in both therapeutic and research settings.

Structure of Anti-Human EPO Antibody

Anti-Human EPO Antibody (SAA0420) is a monoclonal antibody, meaning it is produced from a single type of immune cell. It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The antibody has a Y-shaped structure, with the two arms of the Y binding to the EPO protein.

Mechanism of Action

The primary function of Anti-Human EPO Antibody is to bind to the EPO protein and block its activity. EPO binds to its receptor on the surface of red blood cell precursors, stimulating their proliferation and differentiation into mature red blood cells. By inhibiting this interaction, the antibody prevents the production of new red blood cells.

Therapeutic Target

Anti-Human EPO Antibody has been identified as a potential therapeutic target for conditions associated with abnormal red blood cell production. These include anemia, polycythemia, and certain types of cancer. In patients with anemia, the antibody can be used to reduce the production of red blood cells, thereby preventing the thickening of blood and reducing the risk of blood clots. In polycythemia, where there is an excessive production of red blood cells, the antibody can be used to decrease the number of red blood cells and improve symptoms such as fatigue and shortness of breath. In cancer, EPO is often overproduced, leading to the growth of new blood vessels to support tumor growth. By targeting EPO, the antibody can potentially inhibit this process and slow down tumor growth.

Research Use

In addition to its potential therapeutic applications, Anti-Human EPO Antibody is also widely used in research. It is a valuable tool for studying the role of EPO in various biological processes, such as erythropoiesis, angiogenesis, and inflammation. The antibody can be used in experiments to block EPO activity and observe the effects on these processes. It can also be used to detect and measure EPO levels in biological samples, providing valuable insights into EPO production and regulation.

Application of Anti-Human EPO Antibody

Anti-Human EPO Antibody has a wide range of applications in both therapeutic and research settings. In the clinic, it has the potential to be a novel treatment for conditions associated with abnormal red blood cell production. In research, it is a valuable tool for studying the role of EPO in various biological processes and can aid in the development of new therapies targeting EPO.

Conclusion

In summary, Anti-Human EPO Antibody (SAA0420) is a highly specific monoclonal antibody that targets the human EPO protein. Its structure, mechanism of action, and potential applications make it a valuable tool for both therapeutic and research purposes. Further studies and clinical trials are needed to fully understand the potential of this antibody in treating various conditions associated with abnormal red blood cell production.

SDS-PAGE for Anti-Human EPO Antibody (SAA0420)

SDS-PAGE for Anti-Human EPO Antibody (SAA0420)

Anti-Human EPO Antibody (SAA0420), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human EPO Antibody (SAA0420)

There are no reviews yet.

Be the first to review “Anti-Human EPO Antibody (SAA0420)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products