Brand: ProteoGenix

Anti-ZEBOV VP40/Matrix protein VP40 Antibody (DSTL094)

ARO-A17435-50
Quality Chart

Clonality:: Monoclonal Antibody
Isotype:: IgG

Original price was: $426.00.Current price is: $315.00.

50ug 26% OFF + 315 loyalty points

Size Size

50ug Original price was: $426.00.Current price is: $315.00.
100ug Original price was: $546.00.Current price is: $451.00.
1MG Original price was: $1,792.00.Current price is: $1,308.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-ZEBOV VP40/Matrix protein VP40 Antibody (DSTL094)

Product name	ARO-A17435-100
Uniprot ID	Q77DJ6
Raw Antigen Sequence	MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-VP40, Anti-Matrix protein VP40
Isotype	IgG
Clonality	Monoclonal Antibody
Protein Name	VP40

Product name	ARO-A17435-1MG
Uniprot ID	Q77DJ6
Raw Antigen Sequence	MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-VP40, Anti-Matrix protein VP40
Isotype	IgG
Clonality	Monoclonal Antibody
Protein Name	VP40

Product name	ARO-A17435-50
Uniprot ID	Q77DJ6
Raw Antigen Sequence	MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-VP40, Anti-Matrix protein VP40
Isotype	IgG
Clonality	Monoclonal Antibody
Protein Name	VP40

Datasheet

SDS-PAGE for Anti-ZEBOV VP40/Matrix protein VP40 Antibody (DSTL094)

Anti-ZEBOV VP40/Matrix protein VP40 Antibody (DSTL094), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-ZEBOV VP40/Matrix protein VP40 Antibody (DSTL094)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-ZEBOV VP40/Matrix protein VP40 Antibody (DSTL094)

Anti-ZEBOV VP40/Matrix protein VP40 Antibody (DSTL094)

SDS-PAGE for Anti-ZEBOV VP40/Matrix protein VP40 Antibody (DSTL094)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-ZEBOV VP40/Matrix protein VP40 Antibody (DSTL094)

Specifications Anti-ZEBOV VP40/Matrix protein VP40 Antibody (DSTL094)

Documents

QC & Validation

SDS-PAGE for Anti-ZEBOV VP40/Matrix protein VP40 Antibody (DSTL094)

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-ZEBOV VP40/Matrix protein VP40 Antibody (DSTL094)