Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Olintatug Biosimilar – Anti-RU2AS mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $218.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Olintatug Biosimilar - Anti-RU2AS mAb - Research Grade

Product name PX-TA2205-50
Uniprot ID Q9UBP8
Source CAS: 2851870-28-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-RU2AS, Kidney-associated antigen 1, KAAG1, RU2 antisense gene protein
Reference PX-TA2205-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Olintatug Biosimilar - Anti-RU2AS mAb - Research Grade
Uniprot ID Q9UBP8
Source CAS: 2851870-28-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-RU2AS, Kidney-associated antigen 1, KAAG1, RU2 antisense gene protein
Reference PX-TA2205-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Olintatug Biosimilar - Anti-RU2AS mAb - Research Grade
Uniprot ID Q9UBP8
Source CAS: 2851870-28-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-RU2AS, Kidney-associated antigen 1, KAAG1, RU2 antisense gene protein
Reference PX-TA2205-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Olintatug Biosimilar is a therapeutic antibody that targets the RU2AS protein. This biosimilar is a research grade product that has been developed for use in scientific studies and research. In this article, we will explore the structure, activity, and potential applications of Olintatug Biosimilar in greater detail.

Structure of Olintatug Biosimilar

Olintatug Biosimilar is a monoclonal antibody (mAb) that is designed to mimic the structure of the original Olintatug therapeutic antibody. It is composed of two identical heavy chains and two identical light chains, which are linked together by disulfide bonds. The heavy chains contain the antigen-binding region, while the light chains are responsible for stabilizing the antibody structure.

The amino acid sequence of Olintatug Biosimilar is highly similar to that of the original Olintatug therapeutic antibody, with only minor differences. This ensures that the biosimilar has a similar structure and function to the original antibody, making it a suitable substitute for research purposes.

Activity of Olintatug Biosimilar

Olintatug Biosimilar targets the RU2AS protein, which is a therapeutic target for various autoimmune disorders. The antibody binds to the RU2AS protein with high specificity and affinity, preventing it from interacting with its receptors and exerting its pathological effects.

The binding of Olintatug Biosimilar to RU2AS also triggers a series of immune responses, including complement activation and antibody-dependent cell-mediated cytotoxicity. These responses help to eliminate the target protein and reduce inflammation and tissue damage in autoimmune diseases.

Applications of Olintatug Biosimilar

Olintatug Biosimilar has a wide range of potential applications in scientific research. It can be used to study the structure and function of the RU2AS protein and its role in autoimmune diseases. The biosimilar can also be used to investigate the mechanism of action of Olintatug and other therapeutic antibodies targeting RU2AS.

In addition, Olintatug Biosimilar can be used in preclinical studies to assess the safety and efficacy of potential new treatments for autoimmune disorders. Its high similarity to the original Olintatug antibody makes it a valuable tool for evaluating the potential of new therapeutic agents.

Furthermore, Olintatug Biosimilar can be used as a positive control in various assays and experiments, ensuring the accuracy and reliability of results. Its consistent structure and activity make it a reliable reference for comparison with other antibodies and biological molecules.

Conclusion

Olintatug Biosimilar is a research grade therapeutic antibody that targets the RU2AS protein. Its structure is similar to the original Olintatug antibody, and it has high specificity and affinity for its target. The biosimilar has various potential applications in scientific research, including the study of autoimmune diseases and the evaluation of new therapeutic agents. Its consistent structure and activity make it a valuable tool for preclinical studies and quality control in research experiments.

SDS-PAGE for Olintatug Biosimilar - Research Grade

SDS-PAGE for Olintatug Biosimilar - Research Grade

Olintatug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Olintatug Biosimilar – Anti-RU2AS mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products