Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bosakitug Biosimilar – Anti-TSLP mAb – Research Grade

  • PX-TA2178-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $220.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Bosakitug Biosimilar - Anti-TSLP mAb - Research Grade

Product name PX-TA2178-50
Uniprot ID Q969D9
Source CAS: 2762183-23-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TSLP, Thymic stromal lymphopoietin
Reference PX-TA2178-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Bosakitug Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2762183-23-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TSLP, Thymic stromal lymphopoietin
Reference PX-TA2178-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Bosakitug Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2762183-23-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TSLP, Thymic stromal lymphopoietin
Reference PX-TA2178-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Bosakitug Biosimilar – Anti-TSLP mAb is a therapeutic antibody that has been developed as a biosimilar to the original anti-TSLP monoclonal antibody (mAb) known as Bosakitug. This biosimilar has been designed to have a similar structure and activity to the original Bosakitug, while also providing a more cost-effective and accessible treatment option for patients. In this article, we will provide a comprehensive description of Bosakitug Biosimilar – Anti-TSLP mAb, including its structure, activity, and potential applications as a therapeutic antibody.

Structure of Bosakitug Biosimilar – Anti-TSLP mAb

Bosakitug Biosimilar – Anti-TSLP mAb is a monoclonal antibody that specifically targets the cytokine thymic stromal lymphopoietin (TSLP). It is a fully humanized antibody, meaning that it is derived from human cells and contains only human components. The antibody consists of two heavy chains and two light chains, which are connected by disulfide bonds to form a Y-shaped structure. The variable regions of the antibody, which are responsible for binding to TSLP, are located at the tips of the Y-shaped structure.

Activity of Bosakitug Biosimilar – Anti-TSLP mAb

Bosakitug Biosimilar – Anti-TSLP mAb works by binding to TSLP, a cytokine that is involved in the development and progression of various inflammatory and allergic diseases. By binding to TSLP, the antibody blocks its interaction with its receptor, thereby inhibiting its activity. This leads to a reduction in the release of pro-inflammatory cytokines and chemokines, as well as a decrease in the activation of immune cells, resulting in an overall anti-inflammatory effect.

Potential Applications as a Therapeutic Antibody

Bosakitug Biosimilar – Anti-TSLP mAb has shown promising results in preclinical studies for the treatment of various inflammatory and allergic diseases, including asthma, atopic dermatitis, and allergic rhinitis. In a phase I clinical trial, the biosimilar has also demonstrated a favorable safety and tolerability profile in healthy volunteers. This indicates its potential as a safe and effective treatment option for patients with these conditions.

Asthma

Asthma is a chronic respiratory disease characterized by airway inflammation and hyperresponsiveness, leading to symptoms such as wheezing, coughing, and shortness of breath. TSLP has been identified as a key cytokine in the development of asthma, as it promotes the differentiation and activation of immune cells that contribute to airway inflammation. By targeting TSLP, Bosakitug Biosimilar – Anti-TSLP mAb has the potential to reduce airway inflammation and improve symptoms in patients with asthma.

Atopic Dermatitis

Atopic dermatitis, also known as eczema, is a chronic inflammatory skin disorder that is characterized by dry, itchy, and inflamed skin. TSLP has been implicated in the development of atopic dermatitis, as it promotes the activation of immune cells that contribute to skin inflammation. By blocking TSLP, Bosakitug Biosimilar – Anti-TSLP mAb has the potential to reduce skin inflammation and improve symptoms in patients with atopic dermatitis.

Allergic Rhinitis

Allergic rhinitis, also known as hay fever, is a common allergic condition that is characterized by symptoms such as sneezing, runny nose, and nasal congestion. TSLP has been identified as a key cytokine in the development of allergic rhinitis, as it promotes the activation of immune cells that contribute to nasal inflammation. By targeting TSLP, Bosakitug Biosimilar – Anti-TSLP mAb has the potential to reduce nasal inflammation and improve symptoms in patients with allergic rhinitis.

Conclusion

Bosakitug Biosimilar – Anti-TSLP mAb is a promising therapeutic

Bosakitug Biosimilar - Research Grade binds to Mouse TSLP recombinant protein in ELISA Assay

Bosakitug Biosimilar - Research Grade binds to Mouse TSLP recombinant protein in ELISA Assay

Mouse TSLP recombinant protein(cat. No.PX-P6400) at 0.5µg/mL (100µL/well) can bind Bosakitug Biosimilar - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Bosakitug Biosimilar - Research Grade

SDS-PAGE for Bosakitug Biosimilar - Research Grade

Bosakitug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Bosakitug Biosimilar – Anti-TSLP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products