Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Abiprubart Biosimilar – Anti-Tumor necrosis factor receptor superfamily member 5 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Abiprubart Biosimilar - Anti-Tumor necrosis factor receptor superfamily member 5 mAb - Research Grade

Product name PX-TA2107-50
Uniprot ID P25942
Source CAS: 2765071-95-0
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2107
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Abiprubart Biosimilar - Anti-Tumor necrosis factor receptor superfamily member 5 mAb - Research Grade
Uniprot ID P25942
Source CAS: 2765071-95-0
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2107
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Abiprubart Biosimilar - Anti-Tumor necrosis factor receptor superfamily member 5 mAb - Research Grade
Uniprot ID P25942
Source CAS: 2765071-95-0
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2107
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Abiprubart Biosimilar is a research grade antibody that targets the tumor necrosis factor receptor superfamily member 5 (TNFRSF5), also known as CD40. This antibody has been developed as a biosimilar to the existing anti-CD40 monoclonal antibody (mAb) therapies, with the aim of providing a more affordable and accessible treatment option for patients.

Structure of Abiprubart Biosimilar

Abiprubart Biosimilar is a recombinant humanized monoclonal antibody, meaning it is produced in a laboratory using genetic engineering techniques. The antibody is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions of the antibody are responsible for binding to the CD40 receptor, while the constant regions provide stability and effector functions.

Mechanism of Action

The main function of Abiprubart Biosimilar is to bind to the CD40 receptor on the surface of immune cells, specifically B cells and dendritic cells. This binding activates the CD40 receptor, leading to downstream signaling pathways that ultimately stimulate the immune response. This mechanism of action is similar to that of the existing anti-CD40 mAb therapies, making Abiprubart Biosimilar a potential alternative for patients who may not have access to or cannot afford the currently available treatments.

Therapeutic Applications

Abiprubart Biosimilar has shown promising results in preclinical studies for the treatment of various autoimmune and inflammatory diseases, such as rheumatoid arthritis, systemic lupus erythematosus, and multiple sclerosis. These diseases are characterized by an overactive immune response, and the use of Abiprubart Biosimilar aims to modulate this response and reduce disease symptoms.

In addition to its potential use in autoimmune and inflammatory diseases, Abiprubart Biosimilar has also shown potential as an adjuvant therapy for cancer treatment. By activating the CD40 receptor on immune cells, this antibody can stimulate the immune system to target and destroy cancer cells, making it a promising candidate for combination therapy with other cancer treatments.

Research Grade vs. Clinical Grade

It is important to note that Abiprubart Biosimilar is currently only available as a research grade antibody, meaning it is not yet approved for clinical use. This is because the production and quality control processes for research grade antibodies are different from those for clinical grade antibodies. Research grade antibodies are primarily used for laboratory research and preclinical studies, while clinical grade antibodies must undergo extensive testing and validation to ensure safety and efficacy before they can be used in patients.

Conclusion

In summary, Abiprubart Biosimilar is a recombinant humanized monoclonal antibody that targets the CD40 receptor on immune cells. Its mechanism of action involves activating the CD40 receptor, leading to downstream signaling pathways that stimulate the immune response. This antibody has shown potential for the treatment of autoimmune and inflammatory diseases, as well as for use as an adjuvant therapy in cancer treatment. However, further research and clinical trials are needed before Abiprubart Biosimilar can be approved for clinical use.

SDS-PAGE for Research Grade Abiprubart

SDS-PAGE for Research Grade Abiprubart

Research Grade Abiprubart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Abiprubart Biosimilar - Anti-Tumor necrosis factor receptor superfamily member 5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Abiprubart Biosimilar – Anti-Tumor necrosis factor receptor superfamily member 5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products