Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bremzalerbart Biosimilar – Anti-BETVIA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $208.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade

Product name Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2046
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2046
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA2046-50
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2046
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Bremzalerbart Biosimilar is a monoclonal antibody (mAb) that specifically targets BETVIA, a therapeutic target that has been identified as a potential treatment for various diseases. This biosimilar is a research grade antibody that has been designed to mimic the activity of the original antibody, providing researchers with a tool to study and understand the role of BETVIA in disease.

Structure of Bremzalerbart Biosimilar

Bremzalerbart Biosimilar is a recombinant human IgG1 monoclonal antibody that has been produced using state-of-the-art biotechnology techniques. It has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains, each with a variable and constant region. The variable regions of the antibody are responsible for binding to the target, while the constant regions provide stability and effector functions.

Activity of Bremzalerbart Biosimilar

Bremzalerbart Biosimilar has been specifically designed to target BETVIA, a protein that is involved in various cellular processes, including cell proliferation and survival. BETVIA has been found to be overexpressed in certain types of cancers, making it a promising therapeutic target for cancer treatment. Bremzalerbart Biosimilar binds to BETVIA with high affinity, inhibiting its activity and preventing its downstream effects.

Application of Bremzalerbart Biosimilar

Bremzalerbart Biosimilar has a wide range of potential applications in both research and therapeutic settings. In research, it can be used as a tool to study the role of BETVIA in various diseases, such as cancer and autoimmune disorders. Its high specificity and affinity make it a valuable tool for studying the effects of BETVIA inhibition on cellular processes.

In therapeutic settings, Bremzalerbart Biosimilar has the potential to be used as a treatment for diseases where BETVIA is overexpressed. This includes certain types of cancers, such as breast, lung, and prostate cancer. By inhibiting BETVIA, Bremzalerbart Biosimilar can potentially slow down the growth and spread of cancer cells, leading to improved patient outcomes.

Advantages of Bremzalerbart Biosimilar

As a biosimilar, Bremzalerbart Biosimilar offers several advantages over the original antibody. It has been produced using advanced biotechnology techniques, ensuring high purity and consistency in each batch. This makes it a reliable tool for research and a potential treatment option with minimal side effects.

Furthermore, Bremzalerbart Biosimilar is more cost-effective compared to the original antibody, making it more accessible for researchers and potentially reducing the burden of healthcare costs for patients. Its high specificity and affinity also make it a more potent inhibitor of BETVIA, potentially leading to improved therapeutic outcomes.

Conclusion

Bremzalerbart Biosimilar is a research grade monoclonal antibody that specifically targets BETVIA, a potential therapeutic target for various diseases. Its structure, activity, and potential applications make it a valuable tool for researchers and a promising treatment option for patients. With its advantages over the original antibody, Bremzalerbart Biosimilar has the potential to improve our understanding and treatment of diseases associated with BETVIA.

SDS-PAGE for Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade

SDS-PAGE for Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade

Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Bremzalerbart Biosimilar - Anti-BETVIA mAb - Research Grade

There are no reviews yet.

Be the first to review “Bremzalerbart Biosimilar – Anti-BETVIA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products