Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Brivekimig Biosimilar – Anti-CD252;TNFA;ALB mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
Ig IG single chain of 5 VH (VH-VH-VH'-VH''-VH') monomer

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Brivekimig Biosimilar - Anti-CD252;TNFA;ALB mAb - Research Grade

Product name PX-TA2180-50
Uniprot ID P23510 & P01375 & P02768
Source Trispecific, Pentavalent, CAS: 2834733-45-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD252, OX40L, TXGP1, OX40 ligand, Glycoprotein Gp34, TAX transcriptionally-activated glycoprotein 1, TNFSF4, Tumor necrosis factor ligand superfamily member 4, TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1, ALB, Albumin
Reference PX-TA2180-100
Note For research use only. Not suitable for human use.
Isotype Ig IG single chain of 5 VH (VH-VH-VH'-VH''-VH') monomer
Clonality Monoclonal Antibody
Product name Brivekimig Biosimilar - Anti-CD252;TNFA;ALB mAb - Research Grade
Uniprot ID P23510 & P01375 & P02768
Source Trispecific, Pentavalent, CAS: 2834733-45-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD252, OX40L, TXGP1, OX40 ligand, Glycoprotein Gp34, TAX transcriptionally-activated glycoprotein 1, TNFSF4, Tumor necrosis factor ligand superfamily member 4, TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1, ALB, Albumin
Reference PX-TA2180-100
Note For research use only. Not suitable for human use.
Isotype Ig IG single chain of 5 VH (VH-VH-VH'-VH''-VH') monomer
Clonality Monoclonal Antibody
Product name Brivekimig Biosimilar - Anti-CD252;TNFA;ALB mAb - Research Grade
Uniprot ID P23510 & P01375 & P02768
Source Trispecific, Pentavalent, CAS: 2834733-45-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD252, OX40L, TXGP1, OX40 ligand, Glycoprotein Gp34, TAX transcriptionally-activated glycoprotein 1, TNFSF4, Tumor necrosis factor ligand superfamily member 4, TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1, ALB, Albumin
Reference PX-TA2180-100
Note For research use only. Not suitable for human use.
Isotype Ig IG single chain of 5 VH (VH-VH-VH'-VH''-VH') monomer
Clonality Monoclonal Antibody

Introduction

Brivekimig Biosimilar – Anti-CD252;TNFA;ALB mAb is a research grade therapeutic antibody that has shown promising results in targeting and inhibiting the activity of CD252, TNFA, and ALB. This biosimilar is a potential treatment option for various inflammatory and autoimmune diseases.

Structure

Brivekimig Biosimilar is a monoclonal antibody (mAb) that is produced through recombinant DNA technology. It is a biosimilar of the reference product, which is a therapeutic antibody currently used in the treatment of inflammatory diseases. The structure of Brivekimig Biosimilar is highly similar to the reference product, with minor differences in the amino acid sequence. These differences do not affect the efficacy or safety of the biosimilar.

The mAb is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy and light chains are connected by disulfide bonds, forming a Y-shaped structure. The variable regions of the heavy and light chains are responsible for binding to the target molecules, CD252, TNFA, and ALB.

Activity

Brivekimig Biosimilar works by binding to and inhibiting the activity of CD252, TNFA, and ALB. CD252, also known as OX40L, is a protein that is involved in the activation and proliferation of T cells, which play a crucial role in the development of inflammatory and autoimmune diseases. TNFA, or tumor necrosis factor alpha, is a pro-inflammatory cytokine that is overproduced in many inflammatory diseases. ALB, or albumin, is a protein that is involved in the transport of nutrients and drugs in the body and is also implicated in the development of inflammatory diseases.

By binding to these three targets, Brivekimig Biosimilar effectively blocks their activity, leading to a decrease in inflammation and potentially halting the progression of the disease. This mechanism of action has been demonstrated in preclinical studies, where Brivekimig Biosimilar showed significant inhibition of CD252, TNFA, and ALB activity.

Application

Brivekimig Biosimilar has potential applications in the treatment of various inflammatory and autoimmune diseases, including rheumatoid arthritis, psoriasis, and inflammatory bowel disease. These diseases are characterized by excessive inflammation, which can lead to tissue damage and disability. Current treatment options for these diseases include non-steroidal anti-inflammatory drugs (NSAIDs), corticosteroids, and biologic therapies, such as the reference product of Brivekimig Biosimilar.

However, these treatments may have limited efficacy or cause adverse effects. Brivekimig Biosimilar offers a potential alternative with similar efficacy and safety to the reference product but at a lower cost. This makes it a more accessible treatment option for patients and healthcare systems.

Currently, Brivekimig Biosimilar is in the late stages of development and has not yet been approved for clinical use. However, preclinical studies have shown promising results, and clinical trials are underway to further evaluate its safety and efficacy in human patients. If approved, Brivekimig Biosimilar could provide a more affordable and effective treatment option for patients with inflammatory and autoimmune diseases.

Conclusion

Brivekimig Biosimilar – Anti-CD252;TNFA;ALB mAb is a research grade therapeutic antibody that has shown potential in targeting and inhibiting the activity of CD252, TNFA, and ALB. Its structure is highly similar to the reference product, and its mechanism of action has been demonstrated in preclinical studies. This biosimilar has potential applications in the treatment of various inflammatory and autoimmune diseases, and further clinical trials will determine its safety and efficacy in human patients. If approved, Brivekimig Biosimilar could offer a more affordable and effective treatment option for patients with these debilitating conditions.

SDS-PAGE for Brivekimig Biosimilar - Research Grade

SDS-PAGE for Brivekimig Biosimilar - Research Grade

Brivekimig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Brivekimig Biosimilar – Anti-CD252;TNFA;ALB mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products