Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade

  • PX-TA2210-50
  • Validated WB
Clonality:
Monoclonal Antibody
Isotype:
Ig Fab VH-G1CH1h_L-kappa

Original price was: $232.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Pegrizeprument Biosimilar - Anti-CD28 mAb - Research Grade

Product name PX-TA2210-50
Uniprot ID P10747
Source CAS: 2829316-24-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28
Reference PX-TA2210-100
Note For research use only. Not suitable for human use.
Isotype Ig Fab VH-G1CH1h_L-kappa
Clonality Monoclonal Antibody
Product name Pegrizeprument Biosimilar - Anti-CD28 mAb - Research Grade
Uniprot ID P10747
Source CAS: 2829316-24-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28
Reference PX-TA2210-100
Note For research use only. Not suitable for human use.
Isotype Ig Fab VH-G1CH1h_L-kappa
Clonality Monoclonal Antibody
Product name Pegrizeprument Biosimilar - Anti-CD28 mAb - Research Grade
Uniprot ID P10747
Source CAS: 2829316-24-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28
Reference PX-TA2210-100
Note For research use only. Not suitable for human use.
Isotype Ig Fab VH-G1CH1h_L-kappa
Clonality Monoclonal Antibody

Introduction

Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade is a therapeutic antibody that has been developed to target the CD28 receptor on immune cells. This biosimilar is a highly specific and potent antibody that has shown promising results in pre-clinical and clinical studies. In this article, we will provide a scientific description of the structure, activity and application of Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade.

Structure of Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade

Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade is a monoclonal antibody (mAb) that is produced by recombinant DNA technology. It is a fully humanized antibody, meaning that it is derived from human cells and has a high degree of similarity to the natural antibodies found in the human body. The antibody is composed of two identical heavy chains and two identical light chains, each with a unique amino acid sequence.

The structure of Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade is designed to specifically bind to the CD28 receptor on the surface of T cells. The antibody has a Y-shaped structure with two antigen-binding sites located on the tips of the arms. These antigen-binding sites are highly specific for the CD28 receptor, allowing the antibody to bind to and block the receptor’s activity.

Activity of Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade

The main activity of Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade is to block the CD28 receptor on T cells. The CD28 receptor is a co-stimulatory receptor that is essential for T cell activation and function. When the CD28 receptor is activated, it stimulates T cell proliferation and cytokine production, which are important for the immune response. However, overactivation of the CD28 receptor has been linked to autoimmune diseases and chronic inflammation.

Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade binds to the CD28 receptor and prevents it from being activated by its ligands. This blocks the co-stimulatory signal and inhibits T cell activation, thereby reducing the immune response. This activity has been shown to be effective in treating autoimmune diseases and preventing transplant rejection.

Application of Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade

Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade has a wide range of potential applications in the field of immunotherapy. Its main application is in the treatment of autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and psoriasis. By blocking the CD28 receptor, the antibody can reduce the overactive immune response that is responsible for these diseases.

Another potential application of Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade is in organ transplantation. During organ transplantation, the body’s immune system can attack the transplanted organ, leading to rejection. By inhibiting T cell activation, Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade can prevent this rejection and improve the success of organ transplantation.

Furthermore, Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade can also be used in combination with other therapeutic antibodies to enhance their efficacy. For example, it has been shown to improve the effectiveness of anti-tumor antibodies by inhibiting the suppressive activity of regulatory T cells.

Conclusion

In conclusion, Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade is a highly specific and potent therapeutic antibody that targets the CD28 receptor on immune cells. Its structure is designed to specifically bind to the receptor, and its main activity is to block its co-stimulatory signal. This antibody has a wide range of potential applications in the treatment of autoimmune diseases, organ transplantation, and cancer. Further research and clinical trials

Pegrizeprument Biosimilar - Research Grade binds to Recombinant Mouse CD28 Protein, N-His-SUMO in WB Assay

Pegrizeprument Biosimilar - Research Grade binds to Recombinant Mouse CD28 Protein, N-His-SUMO in WB Assay

Recombinant Mouse CD28 Protein, N-His-SUMO(cat. No.ARO-P11085) can bind Pegrizeprument Biosimilar - Research Grade in Western Blot Assay as detected on gel analysis.

SDS-PAGE for Pegrizeprument Biosimilar - Research Grade

SDS-PAGE for Pegrizeprument Biosimilar - Research Grade

Pegrizeprument Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products