Name: CD278 Recombinant Protein
SKU: PX-P4116-100
Price: 426.00 USD
Availability: InStock

Product name	CD278 Recombinant Protein
Uniprot ID	Q9Y6W8
Uniprot link	http://www.uniprot.org/uniprot/Q9Y6W8
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK
Molecular weight	45kDa
Protein delivered with Tag?	C-terminal Fc Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Met1~ Lys140
Protein Accession	Q9Y6W8
Spec:Entrez GeneID	29851
Spec:NCBI Gene Aliases	AILIM; CD278; CVID1
Spec:SwissProtID	Q8N6W8
NCBI Reference	Q9Y6W8
Aliases /Synonyms	AILIM
Reference	PX-P4116
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “CD278 Recombinant Protein”

$426.00In stock

Size

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PX-TA1505 476$

View product

Tag Antibody

PTX17868 189$

View product