Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Dacetuzumab Biosimilar – Anti-CD40 mAb – Research Grade

  • PX-TA1166-50
  • Validated ELISA FC
Isotype:
IgG1, kappa

Original price was: $130.00.Current price is: $100.00.

50ug 23% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade

Product name Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Source CAS 880486-59-9
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Dacetuzumab,SGN-40,huS2C,CD40,anti-CD40
Reference PX-TA1166
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Source CAS 880486-59-9
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Dacetuzumab,SGN-40,huS2C,CD40,anti-CD40
Reference PX-TA1166
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name PX-TA1166-50
Uniprot ID P25942
Source CAS 880486-59-9
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Dacetuzumab,SGN-40,huS2C,CD40,anti-CD40
Reference PX-TA1166
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Source CAS 880486-59-9
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Dacetuzumab,SGN-40,huS2C,CD40,anti-CD40
Reference PX-TA1166
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Source CAS 880486-59-9
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Dacetuzumab,SGN-40,huS2C,CD40,anti-CD40
Reference PX-TA1166
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody

The Structure of Dacetuzumab Biosimilar – Anti-CD40 mAb

Dacetuzumab Biosimilar, also known as Anti-CD40 monoclonal antibody (mAb), is a type of biologic drug that is designed to mimic the structure and function of a natural antibody. It is a biosimilar version of the original Dacetuzumab, which is an investigational therapeutic antibody targeting CD40, a protein found on the surface of immune cells.

The structure of Dacetuzumab Biosimilar is composed of two heavy chains and two light chains, connected by disulfide bonds. Each heavy chain contains four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while each light chain contains two constant domains (CL and CL’) and one variable domain (VL). The variable domains are responsible for binding to the target protein, CD40.

The Activity of Dacetuzumab Biosimilar

Dacetuzumab Biosimilar works by targeting and binding to CD40, a protein that is expressed on the surface of various immune cells, including B cells, dendritic cells, and macrophages. CD40 is a key regulator of the immune response, and its activation plays a crucial role in the development and progression of various diseases, including cancer, autoimmune disorders, and inflammatory diseases.

By binding to CD40, Dacetuzumab Biosimilar blocks its interaction with its ligand, CD154, which is found on activated T cells. This prevents the activation of downstream signaling pathways, leading to the inhibition of immune cell proliferation and cytokine production. This ultimately results in the suppression of the immune response, which can be beneficial in the treatment of diseases where an overactive immune response is involved.

The Applications of Dacetuzumab Biosimilar

Dacetuzumab Biosimilar is currently being investigated as a potential therapeutic option for various diseases, including hematologic malignancies, solid tumors, and autoimmune disorders. In particular, it is being studied as a treatment for B-cell lymphomas, such as diffuse large B-cell lymphoma (DLBCL) and follicular lymphoma (FL).

In DLBCL, Dacetuzumab Biosimilar is being evaluated in combination with standard chemotherapy regimens, with the aim of improving response rates and overall survival. It is also being studied in combination with other targeted therapies, such as lenalidomide, in patients with relapsed or refractory DLBCL.

In FL, Dacetuzumab Biosimilar is being investigated as a monotherapy and in combination with rituximab, another anti-CD20 mAb, in patients with relapsed or refractory disease. It is also being studied in combination with other targeted therapies, such as idelalisib, in patients with relapsed or refractory FL.

Aside from its potential use in cancer treatment, Dacetuzumab Biosimilar is also being explored as a treatment for autoimmune disorders, such as systemic lupus erythematosus (SLE) and rheumatoid arthritis (RA). In these diseases, it is hypothesized that targeting CD40 could help regulate the overactive immune response and provide therapeutic benefits.

Conclusion

In summary, Dacetuzumab Biosimilar is a biosimilar version of the investigational therapeutic antibody targeting CD40. Its structure is composed of two heavy chains and two light chains, and it works by binding to CD40 and inhibiting its activity. It is currently being studied as a potential treatment option for various diseases, including hematologic malignancies, solid tumors, and autoimmune disorders. Its unique mechanism of action makes it a promising therapeutic option for the treatment of diseases where an overactive immune response is involved.

SDS-PAGE for Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade

SDS-PAGE for Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade

Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Flow Cytometry results for Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow Cytometry results for Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade binds to CD40 Recombinant Protein in ELISA Assay

Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade binds to CD40 Recombinant Protein in ELISA Assay

CD40 Recombinant Protein(cat. No.PX-P4082) at 0.5µg/mL (100µL/well) can bind Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Flow Cytometry results for Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow Cytometry results for Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow-cytometry using PE anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human CD40 monoclonal antibody (Catalog: PX-TA1166, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Dacetuzumab Biosimilar - Anti-CD40 mAb - Research Grade

There are no reviews yet.

Be the first to review “Dacetuzumab Biosimilar – Anti-CD40 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products