Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ecleralimab Biosimilar – Anti-TSLP mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
Fab-G1-lambda2

Original price was: $300.00.Current price is: $238.00.

100ug 21% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade

Product name Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2415207-91-7
Species Humanized
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ecleralimab,CSJ 117, CSJ-117, NVP-CSJ117,TSLP,anti-TSLP
Reference PX-TA1783
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-lambda2
Clonality Monoclonal Antibody
Product name Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2415207-91-7
Species Humanized
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ecleralimab,CSJ 117, CSJ-117, NVP-CSJ117,TSLP,anti-TSLP
Reference PX-TA1783
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-lambda2
Clonality Monoclonal Antibody
Product name PX-TA1783-50
Uniprot ID Q969D9
Source CAS: 2415207-91-7
Species Humanized
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ecleralimab,CSJ 117, CSJ-117, NVP-CSJ117,TSLP,anti-TSLP
Reference PX-TA1783
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-lambda2
Clonality Monoclonal Antibody

Introduction

Ecleralimab Biosimilar, also known as Anti-TSLP mAb, is a monoclonal antibody that has been developed as a potential therapeutic for various inflammatory diseases. This biosimilar is a research grade version of the original Ecleralimab, which has shown promising results in pre-clinical and clinical studies. In this article, we will discuss the structure, activity, and potential applications of Ecleralimab Biosimilar as an antibody targeting TSLP.

Structure of Ecleralimab Biosimilar

Ecleralimab Biosimilar is a humanized monoclonal antibody that specifically targets thymic stromal lymphopoietin (TSLP). It is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa. The antibody has a unique structure that allows it to bind to TSLP with high affinity and specificity.

Activity of Ecleralimab Biosimilar

TSLP is a cytokine that has been implicated in various inflammatory diseases, including asthma, atopic dermatitis, and inflammatory bowel disease. Ecleralimab Biosimilar works by binding to TSLP and preventing it from interacting with its receptor, thereby inhibiting the downstream inflammatory signaling pathways. This activity of Ecleralimab Biosimilar has been demonstrated in both in vitro and in vivo studies.

In vitro studies have shown that Ecleralimab Biosimilar can effectively block the interaction between TSLP and its receptor, leading to a decrease in the production of pro-inflammatory cytokines. In addition, Ecleralimab Biosimilar has been shown to inhibit the activation of immune cells, such as dendritic cells and T cells, which play a crucial role in the development of inflammatory diseases.

In vivo studies have also demonstrated the efficacy of Ecleralimab Biosimilar in various animal models of inflammatory diseases. In a mouse model of asthma, treatment with Ecleralimab Biosimilar significantly reduced airway inflammation and improved lung function. Similarly, in a mouse model of atopic dermatitis, Ecleralimab Biosimilar reduced skin inflammation and improved skin barrier function.

Potential Applications of Ecleralimab Biosimilar

Based on its mechanism of action and pre-clinical data, Ecleralimab Biosimilar has the potential to be used as a therapeutic for various inflammatory diseases. Some of the potential applications of Ecleralimab Biosimilar are discussed below.

1. Asthma: Asthma is a chronic inflammatory disease of the airways, characterized by recurrent episodes of coughing, wheezing, and shortness of breath. TSLP has been identified as a key mediator of airway inflammation in asthma. Therefore, Ecleralimab Biosimilar has the potential to be used as a treatment for asthma, either as a monotherapy or in combination with other asthma medications.

2. Atopic Dermatitis: Atopic dermatitis is a chronic inflammatory skin disease that is characterized by dry, itchy, and inflamed skin. TSLP has been shown to play a crucial role in the development of atopic dermatitis. Therefore, Ecleralimab Biosimilar has the potential to be used as a treatment for atopic dermatitis, either as a monotherapy or in combination with other medications.

3. Inflammatory Bowel Disease (IBD): IBD is a chronic inflammatory disease of the digestive tract, which includes Crohn’s disease and ulcerative colitis. TSLP has been implicated in the pathogenesis of IBD, and Ecleralimab Biosimilar has the potential to be used as a treatment for IBD by targeting TSLP.

4. Other Inflammatory Diseases: TSLP has also been implicated in other inflammatory diseases, such as allergic rhinitis, eosinophilic esophagitis, and chronic obstructive pulmonary disease. Therefore, Ecleralimab Biosimilar has the potential to be used as a treatment for these diseases as well.

Conclusion

In conclusion, Ecleralimab Biosimilar is a promising therapeutic candidate for various inflammatory diseases. Its unique structure and activity as an anti-TSL

SDS-PAGE for Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade

SDS-PAGE for Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade

Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ecleralimab Biosimilar - Anti-TSLP mAb - Research Grade

There are no reviews yet.

Be the first to review “Ecleralimab Biosimilar – Anti-TSLP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products