Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Estrogen receptor (in E.coli)

  • PX-P4797-10
Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P03372
Molecular weight:
29.47 kDa

$169.00

+ 169 loyalty points
Met297–Ser554 N terminus His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Estrogen receptor (in E.coli)

Estrogen receptor (in E.coli)

Product name Estrogen receptor (in E.coli)
Uniprot ID P03372
Uniprot link https://www.uniprot.org/uniprot/P03372
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFV DLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNL QGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILS HIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS
Molecular weight 29.47 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met297-Ser554
Protein Accession P03372
Spec:Entrez GeneID 2099
Spec:NCBI Gene Aliases ER; ESR; Era; ESRA; ESTRR; NR3A1
Spec:SwissProtID Q9UIS7
NCBI Reference P03372
Aliases /Synonyms ER, ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1,ESR, NR3A1
Reference PX-P4797
Note For research use only
Molecular Constructor
Met297–Ser554 N terminus His
Product name Estrogen receptor (in E.coli)
Uniprot ID P03372
Uniprot link https://www.uniprot.org/uniprot/P03372
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFV DLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNL QGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILS HIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS
Molecular weight 29.47 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met297-Ser554
Protein Accession P03372
Spec:Entrez GeneID 2099
Spec:NCBI Gene Aliases ER; ESR; Era; ESRA; ESTRR; NR3A1
Spec:SwissProtID Q9UIS7
NCBI Reference P03372
Aliases /Synonyms ER, ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1,ESR, NR3A1
Reference PX-P4797
Note For research use only
Molecular Constructor
Met297–Ser554 N terminus His

There are no reviews yet.

Be the first to review “Estrogen receptor (in E.coli)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products