Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Etanercept Biosimilar – Anti-TNF mAb – Research Grade

  • PX-TA1015-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1-Fc

$238.00

100ug + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Etanercept Biosimilar - Anti-TNF mAb - Research Grade

Product name Etanercept Biosimilar - Anti-TNF mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00005
Species Human
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 51kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Etanercept,Etanercept,TNF,anti-TNF
Reference PX-TA1015
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype hG1-Fc
Clonality Monoclonal Antibody
Product name Etanercept Biosimilar - Anti-TNF mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00005
Species Human
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 51kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Etanercept,Etanercept,TNF,anti-TNF
Reference PX-TA1015
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype hG1-Fc
Clonality Monoclonal Antibody
Product name PX-TA1015-50
Uniprot ID P01375
Source DrugBank DB00005
Species Human
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 51kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Etanercept,Etanercept,TNF,anti-TNF
Reference PX-TA1015
Note For research use only. Not suitable for human use.
Isotype IgG1-Fc
Clonality Monoclonal Antibody

General information about Etanercept

Etanercept is a biopharmaceutical that treats autoimmune diseases by interfering with tumor necrosis factor (TNF, a soluble inflammatory cytokine) by acting as a TNF inhibitor. It has U.S. F.D.A. approval to treat rheumatoid arthritis, juvenile idiopathic arthritis and psoriatic arthritis, plaque psoriasis and ankylosing spondylitis. TNF-alpha is the “master regulator” of the inflammatory (immune) response in many organ systems. Autoimmune diseases are caused by an overactive immune response. Etanercept has the potential to treat these diseases by inhibiting TNF-alpha. Etanercept is a fusion protein produced by recombinant DNA. It fuses the TNF receptor to the constant end of the IgG1 antibody. First, the developers isolated the DNA sequence that codes the human gene for soluble TNF receptor 2, which is a receptor that binds to tumor necrosis factor-alpha. Second, they isolated the DNA sequence that codes the human gene for the Fc end of immunoglobulin G1 (IgG1). Third, they linked the DNA for TNF receptor 2 to the DNA for IgG1 Fc. Finally, they expressed the linked DNA to produce a protein that links the protein for TNF receptor 2 to the protein for IgG1 Fc. It is a large molecule, with a molecular weight of 150 kDa, that binds to TNF alpha and decreases its role in disorders involving excess inflammation in humans and other animals, including autoimmune diseases such as ankylosing spondylitis, juvenile rheumatoid arthritis, psoriasis, psoriatic arthritis, rheumatoid arthritis, and, potentially, in a variety of other disorders mediated by excess TNFalpha. This product is for research use only.

Etanercept Biosimilar - Anti-TNF mAb binds to TNFa / TNF-alpha, N-His, recombinant protein in indirect ELISA Assay

Etanercept Biosimilar - Anti-TNF mAb binds to TNFa / TNF-alpha, N-His, recombinant protein in indirect ELISA Assay

Immobilized TNFa / TNF-alpha, N-His, recombinant protein (cat. No.PX-P5961) at 0.5µg/mL (100µL/well) can bind to Etanercept Biosimilar - Anti-TNF mAb (cat. No.PX-TA1015) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

SDS-PAGE for Etanercept Biosimilar - Anti-TNF mAb - Research Grade

SDS-PAGE for Etanercept Biosimilar - Anti-TNF mAb - Research Grade

Etanercept Biosimilar - Anti-TNF mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Etanercept Biosimilar - Anti-TNF mAb - Research Grade

There are no reviews yet.

Be the first to review “Etanercept Biosimilar – Anti-TNF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products