Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Golocdacimab Biosimilar – Anti-OLR1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $309.00.Current price is: $238.00.

100ug 23% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade

Product name Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade
Uniprot ID P78380
Species Homo Sapiens
Raw Antigen Sequence MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Golocdacimab,,OLR1,anti-OLR1
Reference PX-TA1846
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda
Clonality Monoclonal Antibody
Product name Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade
Uniprot ID P78380
Species Homo Sapiens
Raw Antigen Sequence MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Golocdacimab,,OLR1,anti-OLR1
Reference PX-TA1846
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda
Clonality Monoclonal Antibody
Product name PX-TA1846-50
Uniprot ID P78380
Species Homo Sapiens
Raw Antigen Sequence MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Golocdacimab,,OLR1,anti-OLR1
Reference PX-TA1846
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Golocdacimab Biosimilar: A Novel Anti-OLR1 Monoclonal Antibody for Therapeutic Targeting

Golocdacimab Biosimilar, also known as Anti-OLR1 mAb, is a cutting-edge monoclonal antibody that has shown promising results in targeting and treating various diseases. This biosimilar is a highly specific and potent antibody that targets the OLR1 protein, making it a valuable tool for therapeutic applications. In this article, we will delve into the structure, activity, and potential applications of Golocdacimab Biosimilar.

Structure of Golocdacimab Biosimilar

Golocdacimab Biosimilar is a monoclonal antibody, which means it is produced from a single clone of immune cells. This antibody is a recombinant protein, meaning it is produced using genetic engineering techniques. It is composed of two identical heavy chains and two identical light chains, making it a Y-shaped molecule. The heavy and light chains are connected by disulfide bonds and together form the antigen-binding region, or the Fab region. The other end of the antibody, known as the Fc region, is responsible for mediating the effector functions of the antibody.

The variable regions of the antibody, located in the Fab region, are responsible for binding to the OLR1 protein. These regions are highly specific and have been engineered to have a high affinity for OLR1, making Golocdacimab Biosimilar a potent therapeutic agent.

Activity of Golocdacimab Biosimilar

The main activity of Golocdacimab Biosimilar is its ability to bind to and inhibit the activity of the OLR1 protein. OLR1, also known as LOX-1, is a cell surface receptor that is involved in various cellular processes, including inflammation, angiogenesis, and lipid metabolism. However, overexpression of OLR1 has been linked to the development and progression of various diseases, such as atherosclerosis, cancer, and diabetes.

By binding to OLR1, Golocdacimab Biosimilar blocks its activity and prevents it from triggering cellular processes that contribute to disease progression. This inhibition of OLR1 has been shown to have a therapeutic effect in various preclinical studies.

Applications of Golocdacimab Biosimilar

Golocdacimab Biosimilar has shown great potential in various therapeutic applications, particularly in the treatment of atherosclerosis and cancer. Atherosclerosis is a condition characterized by the buildup of plaque in the arteries, leading to narrowing and hardening of the arteries. This can increase the risk of heart attack and stroke. Studies have shown that Golocdacimab Biosimilar can reduce plaque formation and inflammation in animal models of atherosclerosis, making it a potential treatment for this disease.

In cancer, OLR1 has been found to be overexpressed in various types of tumors, making it a promising therapeutic target. Preclinical studies have shown that Golocdacimab Biosimilar can inhibit tumor growth and metastasis by targeting OLR1. This antibody has also shown synergistic effects when combined with other cancer treatments, making it a potential candidate for combination therapy.

Aside from these applications, Golocdacimab Biosimilar is also being investigated for its potential in treating other diseases, such as diabetes, neurodegenerative disorders, and inflammatory conditions.

Conclusion

Golocdacimab Biosimilar, also known as Anti-OLR1 mAb, is a novel monoclonal antibody that targets the OLR1 protein. Its highly specific and potent activity makes it a valuable tool for therapeutic targeting in various diseases, particularly in atherosclerosis and cancer. With ongoing research and clinical trials, Golocdacimab Biosimilar has the potential to become a promising treatment option for these and other diseases.

SDS-PAGE for Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade

SDS-PAGE for Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade

Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Golocdacimab Biosimilar – Anti-OLR1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products