Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gumokimab Biosimilar – Anti-IL17 mAb – Research Grade

  • PX-TA1767-100
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $616.00.Current price is: $440.00.

100ug 29% OFF + 440 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade

Product name Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade
Uniprot ID Q16552
Source CAS: 2428381-52-4
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Gumokimab,AK 111, AK-111, AK111,IL17,anti-IL17
Reference PX-TA1767
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade
Uniprot ID Q16552
Source CAS: 2428381-52-4
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Gumokimab,AK 111, AK-111, AK111,IL17,anti-IL17
Reference PX-TA1767
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1767-50
Uniprot ID Q16552
Source CAS: 2428381-52-4
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Gumokimab,AK 111, AK-111, AK111,IL17,anti-IL17
Reference PX-TA1767
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Gumokimab Biosimilar

Gumokimab Biosimilar, also known as Anti-IL17 mAb, is a research grade monoclonal antibody that targets the cytokine interleukin-17 (IL-17). This antibody is designed to mimic the function of the natural antibody produced by the body, but with enhanced specificity and potency. Gumokimab Biosimilar is currently being studied as a potential therapeutic option for various inflammatory and autoimmune diseases. In this article, we will explore the structure, activity, and potential applications of Gumokimab Biosimilar.

Structure of Gumokimab Biosimilar

Gumokimab Biosimilar is a recombinant humanized monoclonal antibody, meaning it is produced in a laboratory using genetic engineering techniques. It is composed of two heavy chains and two light chains, each with a unique sequence of amino acids. The heavy and light chains are connected by disulfide bonds, forming a Y-shaped structure. At the top of the Y, the variable regions of the heavy and light chains come together to form the antigen-binding site, which is responsible for binding to its target, IL-17.

Activity of Gumokimab Biosimilar

As an anti-IL17 mAb, the main activity of Gumokimab Biosimilar is to bind to IL-17 and inhibit its function. IL-17 is a pro-inflammatory cytokine that plays a key role in the immune response to infections and tissue damage. However, excessive or dysregulated production of IL-17 has been linked to various inflammatory and autoimmune diseases, such as psoriasis, rheumatoid arthritis, and inflammatory bowel disease. By binding to IL-17, Gumokimab Biosimilar prevents it from interacting with its receptors on immune cells, thus reducing the inflammatory response.

In addition to its direct inhibitory effect on IL-17, Gumokimab Biosimilar also has an indirect anti-inflammatory activity. IL-17 is known to stimulate the production of other pro-inflammatory cytokines, such as tumor necrosis factor-alpha (TNF-α) and interleukin-6 (IL-6). By blocking IL-17, Gumokimab Biosimilar can also decrease the production of these cytokines and further reduce inflammation.

Applications of Gumokimab Biosimilar

Gumokimab Biosimilar is currently being studied for its potential use in various inflammatory and autoimmune diseases. One of the most promising applications is in the treatment of psoriasis, a chronic skin condition characterized by red, scaly patches. IL-17 has been identified as a key player in the pathogenesis of psoriasis, and clinical trials have shown that blocking IL-17 with monoclonal antibodies, including Gumokimab Biosimilar, can significantly improve symptoms.

In addition to psoriasis, Gumokimab Biosimilar is also being investigated for its potential in other inflammatory conditions, such as rheumatoid arthritis and ankylosing spondylitis. These diseases are characterized by chronic inflammation of the joints, and IL-17 has been implicated in their development. Preliminary studies have shown promising results, suggesting that Gumokimab Biosimilar may be an effective treatment option for these conditions as well.

Furthermore, Gumokimab Biosimilar may also have potential in the treatment of inflammatory bowel disease (IBD), including Crohn’s disease and ulcerative colitis. These conditions are characterized by chronic inflammation of the digestive tract, and IL-17 has been shown to play a role in their pathogenesis. Clinical trials are currently underway to evaluate the efficacy and safety of Gumokimab Biosimilar in IBD patients.

Conclusion

In summary, Gumokimab Biosimilar is a research grade monoclonal antibody that targets the cytokine IL-17. Its unique structure and activity allow it to inhibit IL-17 and reduce inflammation, making it a potential therapeutic option for various inflammatory and autoimmune diseases. Further studies are needed to fully understand the potential of Gumokimab Biosimilar, but it holds promise as a novel

Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade in ELISA Assay

Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade in ELISA Assay

Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade

SDS-PAGE for Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade

Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade

There are no reviews yet.

Be the first to review “Gumokimab Biosimilar – Anti-IL17 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products