Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody

  • ARO-A16089-50
  • Validated FC WB

Original price was: $349.00.Current price is: $275.00.

50ug 21% OFF + 275 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody binds to Mouse CD126 recombinant protein in WB Assay
Flow Cytometry results for Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody
Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody

Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody

Product name ARO-A16089-100
Uniprot ID P08887
Uniprot link P08887
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms sIL6R, Interleukin-6 receptor subunit alpha, CD126, IL-6R 1, IL-6R subunit alpha, Membrane glycoprotein 80, gp80, IL6R, IL-6RA, IL-6 receptor subunit alpha, IL-6R-alpha
Reference ARO-A16089
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD126/IL6R/IL-6RA (SAA0048)
Clone Name SAA0048
Protein Name CD126/IL6R/IL-6RA (SAA0048)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16089-1MG
Uniprot ID P08887
Uniprot link P08887
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms sIL6R, Interleukin-6 receptor subunit alpha, CD126, IL-6R 1, IL-6R subunit alpha, Membrane glycoprotein 80, gp80, IL6R, IL-6RA, IL-6 receptor subunit alpha, IL-6R-alpha
Reference ARO-A16089
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD126/IL6R/IL-6RA (SAA0048)
Clone Name SAA0048
Protein Name CD126/IL6R/IL-6RA (SAA0048)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16089-50
Uniprot ID P08887
Uniprot link P08887
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms sIL6R, Interleukin-6 receptor subunit alpha, CD126, IL-6R 1, IL-6R subunit alpha, Membrane glycoprotein 80, gp80, IL6R, IL-6RA, IL-6 receptor subunit alpha, IL-6R-alpha
Reference ARO-A16089
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD126/IL6R/IL-6RA (SAA0048)
Clone Name SAA0048
Protein Name CD126/IL6R/IL-6RA (SAA0048)
Target species Anti-Human Monoclonal Antibody

Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody binds to Mouse CD126 recombinant protein in WB Assay

Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody binds to Mouse CD126 recombinant protein in WB Assay

Mouse CD126 recombinant protein(cat. No.PX-P6391) can bind Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody in Western Blot Assay as detected on gel analysis.

Flow Cytometry results for Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody

Flow Cytometry results for Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody

Target Cells were stained with an irrelevant antibody or Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products