Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD159c recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P26717
Molecular weight:
18.50 kDa

Original price was: $419.00.Current price is: $327.00.

100ug 22% OFF + 327 loyalty points
Glu98–Leu231 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD159c recombinant protein

Human CD159c recombinant protein

Product name PX-P6372-100
Uniprot ID P26717
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EQNNFSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
Molecular weight 18.50 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu98-Leu231
Aliases /Synonyms CD159 antigen-like family member C, NK cell receptor C, NKG2-C-activating NK receptor, CD159c, KLRC2, NKG2CNKG2-C type II integral membrane protein,
Reference PX-P6372
Molecular Constructor
Glu98–Leu231 His
Product name PX-P6372-1MG
Uniprot ID P26717
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EQNNFSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
Molecular weight 18.50 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu98-Leu231
Aliases /Synonyms CD159 antigen-like family member C, NK cell receptor C, NKG2-C-activating NK receptor, CD159c, KLRC2, NKG2CNKG2-C type II integral membrane protein,
Reference PX-P6372
Molecular Constructor
Glu98–Leu231 His
Product name PX-P6372-50
Uniprot ID P26717
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EQNNFSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
Molecular weight 18.50 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu98-Leu231
Aliases /Synonyms CD159 antigen-like family member C, NK cell receptor C, NKG2-C-activating NK receptor, CD159c, KLRC2, NKG2CNKG2-C type II integral membrane protein,
Reference PX-P6372
Molecular Constructor
Glu98–Leu231 His

Human CD159c recombinant protein

There are no reviews yet.

Be the first to review “Human CD159c recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products