Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human FGF1 Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human FGF1 Recombinant Protein |
|---|---|
| Uniprot ID | P05230 |
| Uniprot link | http://www.uniprot.org/uniprot/P05230 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MEMAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSDLEHHHHHH |
| Molecular weight | 18.78 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 85% |
| Buffer | PBS,pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| NCBI Reference | P05230 |
| Aliases /Synonyms | ECGF, AFGF, ECGFA, ECGFB, FGF-Alpha, FGFA, HBGF1, ECGFB, HBGF1, Acidic Fibroblast Growth Factor proteins, heparin-binding Growth Factor proteins 1, Endothelial Cell Growth Factor proteins, Beta |
| Reference | PX-P3028 |
| Note | For research use only |
SDS-PAGE for Human ErbB2 Recombinant Protein
Human ErbB2 Recombinant Protein, on SDS-PAGE under reducing
Related products
Biosimilar
Biciromab Biosimilar – Anti-Fibrin II beta chain,fibrin mAb – Research Grade
PX-TA1091 238$
Biosimilar
Gantenerumab Biosimilar – Anti-APP , Abeta42, Abeta40 mAb – Research Grade
PX-TA1158 143$
Biosimilar
Solanezumab Biosimilar – Anti-APP Abeta,soluble monomer mAb – Research Grade
PX-TA1211 238$
Biosimilar
Polatuzumab Biosimilar – Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb – Research Grade
PX-TA1317 143$
Biosimilar
Trontinemab Biosimilar – Anti-APP Abeta 1-40, 42;TFRC mAb – Research Grade
PX-TA1887 238$
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.